HMGB1/HMG-1 Protein, Human (HEK293, Fc)

1. Measured by its ability to induce TNF-alpha secretion by RAW 264.7 mouse monocyte/macrophage cells. The ED₅₀ for this effect is 3.920 μg/mL, corresponding to a specific activity is 255.102 U/mg.
2. Measured by its binding ability in a functional ELISA . Immobilized recombinant mouse AGER at 2 μg/ml (100 μl/well) can bind human HMGB1. The EC₅₀ of human HMGB1 is 0.23 μg/ml .

• 
  Measured by its ability to induce TNF-alpha secretion by RAW 264.7 mouse monocyte/macrophage cells. The ED₅₀ for this effect is 3.920 μg/mL, corresponding to a specific activity is 255.102 U/mg.

Human

HEK293

N-hFc

P09429/NP_002119.1 (M1-E215)

3146  [NCBI]

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Approximately 59.78 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.