1. Protéines recombinantes
  2. Others
  3. HMGB1/HMG-1 Protein, Human (HEK293, Fc)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V(D)J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (HEK293, Fc) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by HEK293 , with N-hFc labeled tag.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Prix Stock Quantité
Échantillon gratuit (5 μg)   Apply now
5 μg En stock
10 μg En stock
20 μg En stock
50 μg En stock
100 μg En stock
> 100 μg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products

2 Publications Citing Use of MCE HMGB1/HMG-1 Protein, Human (HEK293, Fc)

Cell Proliferation/Viability Assay
WB

    HMGB1/HMG-1 Protein, Human (HEK293, Fc) purchased from MCE. Usage Cited in: FEBS Open Bio. 2023 Feb;13(2):246-256.  [Abstract]

    HMGB1/HMG-1 Protein, Human (HEK293, Fc) (1 μg/mL; 37℃; 48 h) significantly increased cell viability in HUVECs with IH or normoxic conditions.

    HMGB1/HMG-1 Protein, Human (HEK293, Fc) purchased from MCE. Usage Cited in: FEBS Open Bio. 2023 Feb;13(2):246-256.  [Abstract]

    HMGB1/HMG-1 Protein, Human (HEK293, Fc) (1 μg/mL; 37℃; 48 h) significantly enhanced the protein expression levels of TLR4, p-NF-κB p65, VEGF and MMP9 in HUVECs with IH or normoxic conditions..
    • Activité biologique

    • Paramètres Techniques

    • Propriétés

    • Description

    Description

    The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V(D)J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (HEK293, Fc) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by HEK293 , with N-hFc labeled tag.

    Background

    HMGB1/HMG-1, a multifunctional redox-sensitive protein, exhibits diverse roles across different cellular compartments. Within the nucleus, it stands as a major chromatin-associated non-histone protein, functioning as a DNA chaperone involved in crucial processes such as replication, transcription, chromatin remodeling, V(D)J recombination, DNA repair, and genome stability. Proposed as a universal biosensor for nucleic acids, HMGB1/HMG-1 plays a pivotal role in promoting the host inflammatory response to both sterile and infectious signals, coordinating innate and adaptive immune responses. In the cytoplasm, it serves as a sensor and/or chaperone for immunogenic nucleic acids, activating TLR9-mediated immune responses and mediating autophagy. Released to the extracellular environment, HMGB1/HMG-1 engages with various molecules such as DNA, nucleosomes, IL-1 beta, CXCL12, AGER isoform 2/sRAGE, lipopolysaccharide (LPS), and lipoteichoic acid (LTA), activating cells through multiple surface receptors. The extracellular HMGB1 exists in different redox states, with fully reduced HMGB1 acting as a chemokine, disulfide HMGB1 as a cytokine, and sulfonyl HMGB1 promoting immunological tolerance. Beyond its immunomodulatory roles, HMGB1/HMG-1 is implicated in proangiogenic activity, platelet activation, neuronal outgrowth signaling via RAGE, and potential involvement in the accumulation of expanded polyglutamine proteins. Its nuclear functions, attributed to fully reduced HMGB1, include association with chromatin, DNA bending, and enhancement of DNA flexibility through looping, facilitating various gene promoter activities. Additionally, HMGB1/HMG-1 may play roles in nucleotide excision repair, mismatch repair, base excision repair, double-strand break repair, V(D)J recombination, displacement of histone H1, restructuring nucleosomes, enhancing transcription factor binding, and modulating the telomerase complex. The intricate functions of HMGB1/HMG-1 highlight its significance in diverse cellular processes.

    Activité biologique

    1. Measured by its ability to induce TNF-alpha secretion by RAW 264.7 mouse monocyte/macrophage cells. The ED50 for this effect is 2-5 μg/mL.
    2. Measured by its binding ability in a functional ELISA . Immobilized recombinant mouse AGER at 2 μg/ml (100 μl/well) can bind human HMGB1. The EC50 of human HMGB1 is 0.23 μg/mL.

    • Measured by its ability to induce TNF-alpha secretion by RAW 264.7 mouse monocyte/macrophage cells. The ED50 for this effect is 3.920 μg/mL, corresponding to a specific activity is 255.102 U/mg.
    Species

    Human

    Source

    HEK293

    Tag

    N-hFc

    Accession

    P09429/NP_002119.1 (M1-E215)

    Gene ID
    Molecular Construction
    N-term
    hFc
    HMGB1 (M1-E215)
    Accession # P09429/NP_002119.1
    C-term
    Protein Length

    Full Length

    Synonyms
    High mobility group protein B1; HMG-1; HMGB1; HMG1
    AA Sequence

    MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

    Masse moléculaire

    Approximately 55-65 kDa, based on SDS-PAGE under reducing condition, due to the glycosylation.

    Glycosylation
    Yes
    Pureté
    • ≥ 90%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
    2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
    Please refer to the lot-specific COA for specific buffer information.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Livraison

    Room temperature in continental US; may vary elsewhere.

    Documentation

    HMGB1/HMG-1 Protein, Human (HEK293, Fc) Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Vos produits récemment consultés:

    Demande en ligne

    Your information is safe with us. * Required Fields.

    HMGB1/HMG-1 Protein, Human (HEK293, Fc)

     

    Requested Quantity *

    Nom du demandeur *

     

    Civilité

    Adresse e-mail *

     

    Numéro de téléphone *

    Department

     

    Nom de l'organisation *

    City

    État

    Country or Region *

         

    Remarques

    Bulk Inquiry

    Inquiry Information

    Nom du produit:
    HMGB1/HMG-1 Protein, Human (HEK293, Fc)
    Cat. No.:
    HY-P73102
    Quantité:
    MCE Japan Authorized Agent: