HSF2 Protein, Human (His)
As a DNA-binding protein, HSF2 protein has specific affinity for the heat shock promoter element (HSE), thereby activating transcription. Notably, in higher eukaryotes, the ability of HSF2 to bind to HSE depends on the exposure of cells to heat shock. HSF2 Protein, Human (His) is the recombinant human-derived HSF2 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
As a DNA-binding protein, HSF2 protein has specific affinity for the heat shock promoter element (HSE), thereby activating transcription. Notably, in higher eukaryotes, the ability of HSF2 to bind to HSE depends on the exposure of cells to heat shock. HSF2 Protein, Human (His) is the recombinant human-derived HSF2 protein, expressed by E. coli , with N-6*His labeled tag.
The HSF2 protein serves as a DNA-binding factor with a distinct affinity for heat shock promoter elements (HSE), facilitating the activation of transcription. Notably, in higher eukaryotes, HSF2 demonstrates an intriguing behavior—it remains incapable of binding to HSE unless cells undergo heat shock conditions. Found predominantly as a homodimer in normal cellular states, HSF2 undergoes a transformative shift to a DNA-binding homotrimer configuration in response to cellular stress or heat shock. This trimeric form of HSF2 plays a critical role in initiating transcription, thereby regulating the expression of genes crucial for the cellular response to stress. The dynamic interplay between homodimeric and homotrimeric states underscores the nuanced regulatory function of HSF2 in orchestrating cellular responses to environmental challenges. (
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q03933 (S411-S536)
-
Molecular Construction
-
N-term
-
6*His
-
HSF2 (S411-S536)
Accession # Q03933 -
C-term
-
-
Protein Length
Partial
-
Synonyms
HSF2; HSF 2; Heat Shock Transcription Factor 2; Alternative Protein HSF2; Heat Shock Factor Protein 2; HSF2 Protein; HSTF 2; HSTF2
-
AA Sequence
SENKGLETTKNNVVQPVSEEGRKSKSKPDKQLIQYTAFPLLAFLDGNPASSVEQASTTASSEVLSSVDKPIEVDELLDSSLDPEPTQSKLVRLEPLTEAEASEATLFYLCELAPAPLDSDMPLLDS
-
Predicted Molecular Mass
15.9 kDa
-
Molecular Weight
Approximately 26 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)