HSP90AA1 Protein, Sus scrofa (sf9, His)
HSP90AA1 is a molecular chaperone that regulates target proteins involved in cell cycle control and signal transduction. It interacts with co-chaperones to regulate substrate recognition and chaperone function. HHSP90AA1 Protein, Sus scrofa (sf9, His) is the recombinant HSP90AA1 protein, expressed by sf9 insect cells , with N-6*His labeled tag.
- Species: Others
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
HSP90AA1 is a molecular chaperone that regulates target proteins involved in cell cycle control and signal transduction. It interacts with co-chaperones to regulate substrate recognition and chaperone function. HHSP90AA1 Protein, Sus scrofa (sf9, His) is the recombinant HSP90AA1 protein, expressed by sf9 insect cells , with N-6*His labeled tag.
Background
HSP90AA1, a molecular chaperone, intricately facilitates the maturation, structural maintenance, and precise regulation of specific target proteins critical for functions such as cell cycle control and signal transduction. Its dynamic interaction with various co-chaperones modulates substrate recognition, ATPase cycle, and chaperone function. Engaging with diverse client protein classes through interactions with co-chaperones, HSP90AA1 forms functional chaperone-client complexes. Following the chaperoning process, the properly folded client protein, along with co-chaperone, departs from HSP90 in an ADP-bound partially open conformation. Subsequently, ADP is released, and HSP90 assumes an open conformation, ready for the next cycle. Beyond its chaperone activity, HSP90AA1 plays a pivotal role in mitochondrial import, delivering preproteins to the mitochondrial import receptor TOMM70. Furthermore, it actively participates in regulating the transcription machinery at multiple levels, influencing transcription factor levels, modulating epigenetic modifiers, and contributing to histone eviction from gene promoters. HSP90AA1 also binds bacterial lipopolysaccharide (LPS), mediating LPS-induced inflammatory responses, including TNF secretion by monocytes. Additionally, it antagonizes STUB1-mediated inhibition of TGF-beta signaling and promotes the host antiviral response by associating with TOMM70 and IRF3 or TBK1 in the mitochondrial outer membrane.
Technical Parameters
-
Species Others
-
Source Sf9 insect cells
-
Tag N-6*His
-
Accession
O02705 (V222-R367)
-
Protein Length
Partial
-
Synonyms
HSP90AA1; Heat Shock 86 KDa; Prev. HSPC1; FLJ31884; Prev. HSPCA; HSP90A; Prev. HSPCAL4; HSP 86; HSP90N; HSP86; Hsp89; LAP-2; Hsp90; Heat Shock Protein 90kDa Alpha Family Class A Member 1; Heat Shock Protein 90kDa Alpha (Cytosolic), Class A Member 1; Heat
-
AA Sequence
VEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVR
-
Predicted Molecular Mass
19.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)