ICOS Protein, Human (C136S, C137S, HEK293, His)

ICOS proteins enhance T cell responses to foreign antigens, promote proliferation, lymphokine secretion, upregulation of cell-cell interaction molecules, and help B cells secrete antibodies. ICOS Protein, Human (C136S, C137S, HEK293, His) is the recombinant human-derived ICOS protein, expressed by HEK293 , with C-His labeled tag.

ICOS protein significantly enhances fundamental T-cell responses to foreign antigens, encompassing key activities such as cellular proliferation, lymphokine secretion, up-regulation of cell-cell interaction molecules, and effective facilitation of antibody secretion by B-cells. It proves essential for the efficient interplay between T and B-cells, crucial for normal antibody responses to T-cell-dependent antigens. Despite not influencing the production of interleukin-2, ICOS protein superinduces the synthesis of interleukin-10 and prevents the apoptosis of pre-activated T-cells. Moreover, ICOS plays a critical role in CD40-mediated class switching of immunoglobulin isotypes, demonstrating its multifaceted role in orchestrating immune responses. The protein forms homodimers linked by disulfide bonds, further contributing to its functional characteristics.

Immobilized Human ICOS (C136S, C137S), His Tag at 5 μg/mL (100 μL/Well) on the plate. Dose response curve for Human B7-H2, hFc Tag with the EC₅₀ of 1.0-5.0 ng/mL determined by ELISA.

Human

HEK293

C-8*His

Q9Y6W8-1 (E21-F141, C136S, C137S)

29851  [NCBI]

Partial

EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLSSQLKF

Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.