ICOS Protein, Human (121a.a, HEK293, Fc)

ICOS proteins enhance T cell responses to foreign antigens, promote proliferation, lymphokine secretion, upregulation of cell-cell interaction molecules, and help B cells secrete antibodies. ICOS Protein, Human (121a.a, HEK293, Fc) is the recombinant human-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag. The total length of ICOS Protein, Human (121a.a, HEK293, Fc) is 121 a.a., with molecular weight of ~47 kDa.

ICOS protein significantly enhances fundamental T-cell responses to foreign antigens, encompassing key activities such as cellular proliferation, lymphokine secretion, up-regulation of cell-cell interaction molecules, and effective facilitation of antibody secretion by B-cells. It proves essential for the efficient interplay between T and B-cells, crucial for normal antibody responses to T-cell-dependent antigens. Despite not influencing the production of interleukin-2, ICOS protein superinduces the synthesis of interleukin-10 and prevents the apoptosis of pre-activated T-cells. Moreover, ICOS plays a critical role in CD40-mediated class switching of immunoglobulin isotypes, demonstrating its multifaceted role in orchestrating immune responses. The protein forms homodimers linked by disulfide bonds, further contributing to its functional characteristics.

Human

HEK293

C-hFc

Q9Y6W8 (E21-F141)

29851  [NCBI]

EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKF

Approximately 47 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 .

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.