ICOS Protein, Human (HEK293, His-Fc)

ICOS proteins enhance T cell responses to foreign antigens, promote proliferation, lymphokine secretion, upregulation of cell-cell interaction molecules, and help B cells secrete antibodies. ICOS Protein, Human (HEK293, His-Fc) is the recombinant human-derived ICOS protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

ICOS protein significantly enhances fundamental T-cell responses to foreign antigens, encompassing key activities such as cellular proliferation, lymphokine secretion, up-regulation of cell-cell interaction molecules, and effective facilitation of antibody secretion by B-cells. It proves essential for the efficient interplay between T and B-cells, crucial for normal antibody responses to T-cell-dependent antigens. Despite not influencing the production of interleukin-2, ICOS protein superinduces the synthesis of interleukin-10 and prevents the apoptosis of pre-activated T-cells. Moreover, ICOS plays a critical role in CD40-mediated class switching of immunoglobulin isotypes, demonstrating its multifaceted role in orchestrating immune responses. The protein forms homodimers linked by disulfide bonds, further contributing to its functional characteristics.

Human

HEK293

C-hFc;C-His

Q9Y6W8-1 (E21-F141)

29851  [NCBI]

Partial

EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKF

Approximately 50 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.