ICOS Protein, Mouse (C137S, C138S, HEK293, Fc)

ICOS protein optimizes essential T-cell responses to foreign antigens, fostering proliferation, lymphokine secretion, up-regulation of cell-cell interaction molecules, and effective B-cell antibody secretion. Crucial for efficient T and B-cell communication, ICOS is vital for normal antibody responses to T-cell dependent antigens. While it doesn't increase interleukin-2 production, it superinduces interleukin-10 synthesis. Moreover, ICOS prevents apoptosis in pre-activated T-cells and plays a critical role in CD40-mediated immunoglobulin class switching. It exists as a homodimer connected by disulfide bonds. ICOS Protein, Mouse (C137S, C138S, HEK293, Fc) is the recombinant mouse-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag and C137S, C138S mutation. The total length of ICOS Protein, Mouse (C137S, C138S, HEK293, Fc) is 124 a.a., with molecular weight of 40-52 kDa.

The ICOS protein enhances all fundamental T-cell responses to foreign antigens, including proliferation, secretion of lymphokines, up-regulation of cell-cell interaction molecules, and providing effective help for antibody secretion by B-cells. It is essential for facilitating efficient communication between T and B-cells and for normal antibody responses to T-cell dependent antigens. Although it does not increase the production of interleukin-2, it superinduces the synthesis of interleukin-10. Additionally, it prevents apoptosis of pre-activated T-cells and plays a critical role in CD40-mediated class switching of immunoglobulin isotypes. ICOS exists as a homodimer, connected by disulfide bonds.

1. Immobilized Human B7-H2 His at 1 μg/mL (100 μL/well) can bind Mouse ICOS (C137S C138S, Fc) with a linear range of 0.3-10 ng/mL.
2. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse ICOS at 1 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human rhB7-H2. The ED₅₀ for this effect is 37.18 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse ICOS at 1 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human rhB7-H2 .The ED₅₀ for this effect is 37.18 ng/mL.

Mouse

HEK293

C-hFc

Q9WVS0-1 (E21-L144, C137S, C138S)

54167  [NCBI]

EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLSSQLKLWL

40-52 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of Tris with Glycine, Arginine and NaCl, pH 7.5. Normally trehalose is added as protectant before lyophilization. or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.