1. Recombinant Proteins
  2. Others
  3. IFITM3/Fragilis Protein, Human (HEK293, Fc)

IFITM3/Fragilis Protein, Human (HEK293, Fc)

Cat. No.: HY-P77370
COA Handling Instructions

IFITM3/Fragilis protein, a member of the IFITM family, has antiviral properties. It impedes the entry of viral pathogens, including influenza A, Ebola, and SARS-CoV-2, into cells. This protein is ubiquitously expressed in various tissues, such as the liver (RPKM 370.9) and placenta (RPKM 358.2), among others. IFITM3/Fragilis Protein, Human (HEK293, Fc) is the recombinant human-derived IFITM3/Fragilis protein, expressed by HEK293 , with N-mFc labeled tag. The total length of IFITM3/Fragilis Protein, Human (HEK293, Fc) is 57 a.a., with molecular weight of 33-45 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $38 In-stock
10 μg $64 In-stock
50 μg $180 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IFITM3/Fragilis protein, a member of the IFITM family, has antiviral properties. It impedes the entry of viral pathogens, including influenza A, Ebola, and SARS-CoV-2, into cells. This protein is ubiquitously expressed in various tissues, such as the liver (RPKM 370.9) and placenta (RPKM 358.2), among others. IFITM3/Fragilis Protein, Human (HEK293, Fc) is the recombinant human-derived IFITM3/Fragilis protein, expressed by HEK293 , with N-mFc labeled tag. The total length of IFITM3/Fragilis Protein, Human (HEK293, Fc) is 57 a.a., with molecular weight of 33-45 kDa.

Background

The IFITM3/Fragilis protein is a member of the interferon-induced transmembrane (IFITM) protein family, known for their antiviral properties. This family comprises five members, including IFITM1, IFITM2, and IFITM3, all belonging to the CD225 superfamily. The encoded protein plays a vital role in impeding the entry of various viral pathogens into cells, such as influenza A virus, Ebola virus, and SARS-CoV-2. It exhibits ubiquitous expression in numerous tissues, including the liver (RPKM 370.9), placenta (RPKM 358.2), and 25 other tissues. (

Species

Human

Source

HEK293

Tag

N-mFc

Accession

Q01628/NP_066362.2 (M1-H57)

Gene ID
Molecular Construction
N-term
mFc
IFITM3 (M1-H57)
Accession # NP_066362.2
C-term
Synonyms
Interferon-induced transmembrane protein 3; DSPA2b; Interferon-inducible protein 1-8U
AA Sequence

MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDH

Molecular Weight

33-45 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IFITM3/Fragilis Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFITM3/Fragilis Protein, Human (HEK293, Fc)
Cat. No.:
HY-P77370
Quantity:
MCE Japan Authorized Agent: