1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-alpha
  5. IFN-alpha 13
  6. IFN-alpha 13/IFNA13 Protein, Cynomolgus (HEK293, Fc)

IFN-alpha 13/IFNA13 Protein, Cynomolgus (HEK293, Fc)

Cat. No.: HY-P73122
Handling Instructions Technical Support

IFN-alpha 13 (IFNA13), belongs to type I interferon family, is produced by macrophages with antiviral activities. IFN-alpha 13/IFNA13 Protein, Cynomolgus (HEK293, Fc) contains 166 a.a. (C25-E190), produced in HEK293 cells with a C-terminal hFc-tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-alpha 13 (IFNA13), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 13/IFNA13 Protein, Cynomolgus (HEK293, Fc) contains 166 a.a. (C25-E190), produced in HEK293 cells with a C-terminal hFc-tag.

Background

IFN-alpha 13 (IFNA13; IFN-α13) is produced by the macrophages, belongs to the alpha/beta interferon (IFN) family, a family of cytokines induced by viral infection and are primarily involved in antiviral defense of the cells[1]. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively[2].
Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Interferon alpha (IFNa) shows significant biological activity in various cancers, paticularly haematological malignancies such as hairy cell leukaemia and chronic myelogenous leukaemia[3].
IFN-alpha13 exhibits acid-stable antiviral activity against Theiler's virus, Mengo virus, and vesicular stomatitis virus. Firstly, it is transcribed constitutively, independent of viral infection and of interferon regulatory factor-7 induction. Secondly, it contains two N-glycosylation sites, in contrast to other murine IFN-alpha subtypes that contain either one or no N-glycosylation site[4]. As for a wildly use of IFN in animal model, the sequence of amino acids in IFNA13 protein of human is very different from mouse (64.55%)

Species

Cynomolgus

Source

HEK293

Tag

C-hFc

Accession

G7NFW4 (C25-E190)

Gene ID

/

Molecular Construction
N-term
IFNA13 (C25-E190)
Accession # G7NFW4
hFc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interferon alpha-13; IFN-alpha-13; LeIF D; IFNA13
AA Sequence

CDLPETHSLDNRKTMMLLAQMSRISPSSCLMDRHDFGFPQQEFDGNQFQKAPAISVLHELIQQTFNLFTTKDSSAAWDEDLLDKFCAELYQQLNDLEACVMQQERVGETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSFSLSTNLQERLRRKE

Predicted Molecular Mass
46.4 kDa
Molecular Weight

Approximately 47 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

IFN-alpha 13/IFNA13 Protein, Cynomolgus (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IFN-alpha 13/IFNA13 Protein, Cynomolgus (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-alpha 13/IFNA13 Protein, Cynomolgus (HEK293, Fc)
Cat. No.:
HY-P73122
Quantity:
MCE Japan Authorized Agent: