IFN-alpha 13/IFNA13 Protein, Cynomolgus (HEK293, Fc)

IFN-alpha 13 (IFNA13), belongs to type I interferon family, is produced by macrophages with antiviral activities^[1]. IFN-alpha 13/IFNA13 Protein, Cynomolgus (HEK293, Fc) contains 166 a.a. (C25-E190), produced in HEK293 cells with a C-terminal hFc-tag.

IFN-alpha 13 (IFNA13; IFN-α13) is produced by the macrophages, belongs to the alpha/beta interferon (IFN) family, a family of cytokines induced by viral infection and are primarily involved in antiviral defense of the cells^[1]. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively^[2].
Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Interferon alpha (IFNa) shows significant biological activity in various cancers, paticularly haematological malignancies such as hairy cell leukaemia and chronic myelogenous leukaemia^[3].
IFN-alpha13 exhibits acid-stable antiviral activity against Theiler's virus, Mengo virus, and vesicular stomatitis virus. Firstly, it is transcribed constitutively, independent of viral infection and of interferon regulatory factor-7 induction. Secondly, it contains two N-glycosylation sites, in contrast to other murine IFN-alpha subtypes that contain either one or no N-glycosylation site^[4]. As for a wildly use of IFN in animal model, the sequence of amino acids in IFNA13 protein of human is very different from mouse (64.55%)

Cynomolgus

HEK293

C-hFc

G7NFW4 (C25-E190)

/

Full Length of Mature Protein

CDLPETHSLDNRKTMMLLAQMSRISPSSCLMDRHDFGFPQQEFDGNQFQKAPAISVLHELIQQTFNLFTTKDSSAAWDEDLLDKFCAELYQQLNDLEACVMQQERVGETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSFSLSTNLQERLRRKE

Approximately 47 kDa,based on SDS-PAGE under reducing conditions.

≥ 85%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Kumagai Y, et al. Alveolar macrophages are the primary interferon-alpha producer in pulmonary infection with RNA viruses. Immunity. 2007 Aug;27(2):240-52.  [Content Brief]

  [2]. Zhang SY, et al. Inborn errors of interferon (IFN)-mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40.  [Content Brief]

  [3]. Raj NB, et al. Identification of a novel virus-responsive sequence in the promoter of murine interferon-alpha genes. J Biol Chem. 1991 Jun 15;266(17):11360-5.  [Content Brief]

  [4]. van Pesch V, et al. Characterization of interferon-alpha 13, a novel constitutive murine interferon-alpha subtype. J Biol Chem. 2003 Nov 21;278(47):46321-8.  [Content Brief]