1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-alpha
  5. IFN-alpha 13
  6. IFN-alpha 13/IFNA13 Protein, Mouse (HEK293, Fc)

IFN-alpha 13/IFNA13 Protein, Mouse (HEK293, Fc)

Cat. No.: HY-P73124
Handling Instructions Technical Support

IFN-alpha 13 (IFNA13), belongs to type I interferon family, is produced by macrophages with antiviral activities. IFN-alpha 13/IFNA13 Protein, Mouse (HEK293, Fc) contains 166 a.a. (C24-E189), produced in HEK293 cells with a N-terminal hFc-tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

IFN-alpha 13 (IFNA13), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 13/IFNA13 Protein, Mouse (HEK293, Fc) contains 166 a.a. (C24-E189), produced in HEK293 cells with a N-terminal hFc-tag.

Background

IFN-alpha 13 (IFNA13; IFN-α13) is produced by the macrophages, belongs to the alpha/beta interferon (IFN) family, a family of cytokines induced by viral infection and are primarily involved in antiviral defense of the cells[1]. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively[2].
Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Interferon alpha (IFNa) shows significant biological activity in various cancers, paticularly haematological malignancies such as hairy cell leukaemia and chronic myelogenous leukaemia[3].
IFN-alpha13 exhibits acid-stable antiviral activity against Theiler's virus, Mengo virus, and vesicular stomatitis virus. Firstly, it is transcribed constitutively, independent of viral infection and of interferon regulatory factor-7 induction. Secondly, it contains two N-glycosylation sites, in contrast to other murine IFN-alpha subtypes that contain either one or no N-glycosylation site[4]. As for a wildly use of IFN in animal model, the sequence of amino acids in IFNA13 protein of human is very different from mouse (64.55%)

Species

Mouse

Source

HEK293

Tag

N-hFc

Accession

Q80SU4 (C24-E189)

Gene ID

230396  [NCBI]

Molecular Construction
N-term
hFc
IFNA13 (C24-E189)
Accession # Q80SU4
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interferon alpha-13; IFN-alpha-13; LeIF D; IFNA13
AA Sequence

CDLPQTHNLRNKRALTLLEQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPFVHELTQQILTLFTSNDSSAAWNATLLDSFCNDLHQQLNDLKACLMQQVGVQEFPLTQEDSLLAVRKYFHSITVYLREKKHSPCAWEVVRAEVQRTLSSSANLLARLSKEE

Predicted Molecular Mass
47.5 kDa
분자량

Approximately 60 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
References

IFN-alpha 13/IFNA13 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

IFN-alpha 13/IFNA13 Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
IFN-alpha 13/IFNA13 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P73124
수량:
MCE Japan Authorized Agent: