IFN-alpha 2/IFNA2 Protein, Mouse

IFN-alpha 2/IFNA2 Protein, synthesized by macrophages, exhibits potent antiviral activities. Its interaction with IFNAR2 plays a pivotal role in signaling processes, contributing to the intricate network of antiviral defense mechanisms. IFN-alpha 2/IFNA2 Protein, Mouse is the recombinant mouse-derived IFN-alpha 2/IFNA2 protein, expressed by E. coli, with tag free.

IFN-alpha 2/IFNA2, synthesized primarily by macrophages, possesses potent antiviral activities. Through its interaction with IFNAR2, it engages in crucial signaling processes, contributing to the intricate network of antiviral defense mechanisms.

1. Measured in a cell proliferation assay using TF-1 cells. The ED₅₀ this effect is <0.5 ng/mL.
2. Measured by its binding ability in a functional ELISA. Immobilized Mouse IFNA2 at 2 μg/ml (100 μL/well) can bind Biotinylated Mouse IFNAR2. The ED₅₀ for this effect is 30-40 ng/mL.

• 
  Measured in a cell proliferation assay using TF-1 cells. The ED₅₀ this effect is 0.4718 ng/mL, corresponding to a specific activity is 2.12×10⁶units/mg.

Mouse

E. coli

Tag Free

P01573 (C24-E190)

15965  [NCBI]

Full Length of Mature Protein

CDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNATLLDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE

Approximately 16-19 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 20 mM His-HCl, 6% sucrose, 4% mannitol, 0.02% Tween 80, pH 6.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.