1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-alpha
  5. IFN-alpha 2a
  6. IFN-alpha 2/IFNA2 Protein, Mouse

IFN-alpha 2/IFNA2 Protein, synthesized by macrophages, exhibits potent antiviral activities. Its interaction with IFNAR2 plays a pivotal role in signaling processes, contributing to the intricate network of antiviral defense mechanisms. IFN-alpha 2/IFNA2 Protein, Mouse is the recombinant mouse-derived IFN-alpha 2/IFNA2 protein, expressed by E. coli, with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE IFN-alpha 2/IFNA2 Protein, Mouse

Bio/Physico-chemical Assay

    IFN-alpha 2/IFNA2 Protein, Mouse purchased from MCE. Usage Cited in: Cell Rep. 2024 Apr 23;43(4):114088.  [Abstract]

    IFN-alpha 2/IFNA2 Protein, Mouse (IFNα) (0.1-100 ng/mL; 24 h) induced BST2 expression in BMDMs and THP-1 cells in a concentration-dependent manner.

    IFN-alpha 2/IFNA2 Protein, Mouse purchased from MCE. Usage Cited in: Cell Rep. 2024 Apr 23;43(4):114088.  [Abstract]

    mRNA and protein expression of BST2 in iBMDM cells treated with IFN-alpha 2/IFNA2 Protein, Mouse (IFNα) (50 ng/mL; 24 h).
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    IFN-alpha 2/IFNA2 Protein, synthesized by macrophages, exhibits potent antiviral activities. Its interaction with IFNAR2 plays a pivotal role in signaling processes, contributing to the intricate network of antiviral defense mechanisms. IFN-alpha 2/IFNA2 Protein, Mouse is the recombinant mouse-derived IFN-alpha 2/IFNA2 protein, expressed by E. coli, with tag free.

    Background

    IFN-alpha 2/IFNA2, synthesized primarily by macrophages, possesses potent antiviral activities. Through its interaction with IFNAR2, it engages in crucial signaling processes, contributing to the intricate network of antiviral defense mechanisms.

    Biological Activity

    1. Measured in a cell proliferation assay using TF-1 cells. The ED50 this effect is <0.5 ng/mL.
    2. Measured by its binding ability in a functional ELISA. Immobilized Mouse IFNA2 at 2 μg/ml (100 μL/well) can bind Biotinylated Mouse IFNAR2. The ED50 for this effect is 30-40 ng/mL.

    • Measured in a cell proliferation assay using TF-1 cells. The ED50 this effect is 0.4718 ng/mL, corresponding to a specific activity is 2.12×106units/mg.
    Species

    Mouse

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P01573 (C24-E190)

    Gene ID
    Molecular Construction
    N-term
    IFNA2 (C24-E190)
    Accession # P01573
    C-term
    Protein Length

    Full Length of Mature Protein

    Synonyms
    Interferon alpha 2; IFNA2 Protein, Mouse
    AA Sequence

    CDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNATLLDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE

    Predicted Molecular Mass
    19.5 kDa
    Molecular Weight

    Approximately 16-19 kDa, based on SDS-PAGE under reducing conditions.

    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of 20 mM His-HCl, 6% sucrose, 4% mannitol, 0.02% Tween 80, pH 6.0.
    2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
    Please refer to the lot-specific COA for specific buffer information.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References

    IFN-alpha 2/IFNA2 Protein, Mouse Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    IFN-alpha 2/IFNA2 Protein, Mouse

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    IFN-alpha 2/IFNA2 Protein, Mouse
    Cat. No.:
    HY-P7544
    Quantity:
    MCE Japan Authorized Agent: