1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-alpha
  5. IFN-alpha 4
  6. IFN-alpha 4/IFNA4 Protein, Cynomolgus (HEK293, Fc)

IFN-alpha 4/IFNA4 Protein, Cynomolgus (HEK293, Fc)

Cat. No.: HY-P77391
Handling Instructions Technical Support

IFN-alpha 4 (IFNA4), belongs to type I interferon family, is produced by macrophages with antiviral activities. IFN-alpha 4/IFNA4 Protein, Cynomolgus (HEK293, Fc), produced in HEK293 cells with a C-terminal mFc-tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-alpha 4 (IFNA4), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 4/IFNA4 Protein, Cynomolgus (HEK293, Fc), produced in HEK293 cells with a C-terminal mFc-tag.

Background

IFN-alpha 4 (IFNA4; IFN-α4), belongs to the alpha/beta interferon (IFN) family, is produced by the macrophages with antiviral activities. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively[1].
Interferon alpha (IFNa) shows significant biological activity in various cancers, paticularly haematological malignancies such as hairy cell leukaemia and chronic myelogenous leukaemia[2].
IFN-alpha 4 is the subtypes dominates in IFN-alpha, whose the response with IFNA5, IFNA7, and IFNA14 accounting for up to 85% of the subtypes expressed by Peripheral blood mononuclear cells (PBMCs)[3].
IFN-alpha 4 is promoted by interferon (IFN) regulatory factors (IRFs), especially IRF-1 and IRF-7[5][6]. And it exhibits function by inhibiting virus RNA replication and enhances human natural killer cytotoxicity against virus[4][7].

Species

Cynomolgus

Source

HEK293

Tag

C-mFc

Accession

NP_001181313 (C24-N189)

Gene ID
Protein Length

Full Length of Mature Protein

Synonyms
Interferon alpha-4; IFN-alpha-4; INFA4
AA Sequence

CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQTAQAMSVLHEMIQQTFNLFSTKDSSAAWEQNLLEKFSTELYQQLSDLEACVIQEAGVGETPLMNEDSILAVRKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRKKN

Predicted Molecular Mass
44.9 kDa
Molecular Weight

Approximately 48 kDa, based on SDS-PAGE under reducing conditions.

Structure/Form
disulfide-linked homodimer
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IFN-alpha 4/IFNA4 Protein, Cynomolgus (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IFN-alpha 4/IFNA4 Protein, Cynomolgus (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-alpha 4/IFNA4 Protein, Cynomolgus (HEK293, Fc)
Cat. No.:
HY-P77391
Quantity:
MCE Japan Authorized Agent: