IFN-alpha 6/IFNA6 Protein, Human (His-Myc)

IFN-alpha 6 (IFNA6), belongs to type I interferon family, is produced by macrophages with antiviral activities^[1]. IFN-alpha 6/IFNA6 Protein, Human (His-Myc) contains 169 a.a. (S21-E189), produced in E. coli cells with a N-terminal His-tag and a C-terminal Myc-tag.

IFN-alpha 6 (IFNA6; IFN-α6), belongs to the alpha/beta interferon (IFN) family, is produced by the macrophages with antiviral activities^[1]. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively^[2].
Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Interferon alpha (IFNa) shows significant biological activity in various cancers, paticularly haematological malignancies such as hairy cell leukaemia and chronic myelogenous leukaemia^[3].
Type I interferons (IFNs) are produced early in response to viral infection and modulate adaptive immunity. IFN-alpha 6 involves in acute myocarditis and chronic cardiac inflammation inhibition, promotes systemic murine cytomegalovirus (MCMV) infection by reducing MCMV replication^[4].
As for a wildly use of IFN in animal model, the sequence of amino acids in IFNA6 protein of human is very different from mouse (56.61%)

Humanized IFN-alpha 6 (IFNA6) shows protection on systemic murine cytomegalovirus (MCMV) infection and myocarditis by DNA-inoculated manner, and reduces MCMV replication^[4].

Human

E. coli

N-10*His;C-Myc

P05013 (S21-E189)

3443  [NCBI]

SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE

Approximately 25.1 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Kumagai Y, et al. Alveolar macrophages are the primary interferon-alpha producer in pulmonary infection with RNA viruses. Immunity. 2007 Aug;27(2):240-52.  [Content Brief]

  [2]. Zhang SY, et al. Inborn errors of interferon (IFN)-mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40.  [Content Brief]

  [3]. Raj NB, et al. Identification of a novel virus-responsive sequence in the promoter of murine interferon-alpha genes. J Biol Chem. 1991 Jun 15;266(17):11360-5.  [Content Brief]

  [4]. Cull VS, et al. Type I interferon gene therapy protects against cytomegalovirus-induced myocarditis. Immunology. 2002 Jul;106(3):428-37.  [Content Brief]