IFN-alpha 6/IFNA6 Protein, Human (His-Myc)
IFN-alpha 6 (IFNA6), belongs to type I interferon family, is produced by macrophages with antiviral activities. IFN-alpha 6/IFNA6 Protein, Human (His-Myc) contains 169 a.a. (S21-E189), produced in E. coli cells with a N-terminal His-tag and a C-terminal Myc-tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IFN-alpha 6 (IFNA6), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 6/IFNA6 Protein, Human (His-Myc) contains 169 a.a. (S21-E189), produced in E. coli cells with a N-terminal His-tag and a C-terminal Myc-tag.
Background
IFN-alpha 6 (IFNA6; IFN-α6), belongs to the alpha/beta interferon (IFN) family, is produced by the macrophages with antiviral activities[1]. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively[2].
Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Interferon alpha (IFNa) shows significant biological activity in various cancers, paticularly haematological malignancies such as hairy cell leukaemia and chronic myelogenous leukaemia[3].
Type I interferons (IFNs) are produced early in response to viral infection and modulate adaptive immunity. IFN-alpha 6 involves in acute myocarditis and chronic cardiac inflammation inhibition, promotes systemic murine cytomegalovirus (MCMV) infection by reducing MCMV replication[4].
As for a wildly use of IFN in animal model, the sequence of amino acids in IFNA6 protein of human is very different from mouse (56.61%)
In Vivo
Humanized IFN-alpha 6 (IFNA6) shows protection on systemic murine cytomegalovirus (MCMV) infection and myocarditis by DNA-inoculated manner, and reduces MCMV replication[4].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-10*His;C-Myc
-
Accession
P05013 (S21-E189)
-
Molecular Construction
-
N-term
-
10*His
-
IFNA6 (S21-E189)
Accession # P05013 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IFNA6; Interferon Alpha-K; Interferon Alpha 6; IFN-Alpha-6; IFN-AlphaK; LeIF K; Interferon Alpha-54; Interferon, Alpha 6; Interferon Alpha-6; Interferon 1AB1
-
AA Sequence
SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE
-
Predicted Molecular Mass
25.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
References
[1]. Kumagai Y, et al. Alveolar macrophages are the primary interferon-alpha producer in pulmonary infection with RNA viruses. Immunity. 2007 Aug;27(2):240-52. [Content Brief]
[2]. Zhang SY, et al. Inborn errors of interferon (IFN)-mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40. [Content Brief]
[3]. Raj NB, et al. Identification of a novel virus-responsive sequence in the promoter of murine interferon-alpha genes. J Biol Chem. 1991 Jun 15;266(17):11360-5. [Content Brief]
[4]. Cull VS, et al. Type I interferon gene therapy protects against cytomegalovirus-induced myocarditis. Immunology. 2002 Jul;106(3):428-37. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
