1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-beta
  5. IFN-beta Protein, Mouse (HEK293, Fc)

IFN-β protein is a type I interferon that plays a key role in the innate immune response by binding to IFNAR2 and IFNAR1 receptors and activating Jak-STAT signaling. This results in transcriptional regulation of interferon-regulated genes, affecting antiviral proteins, cell proliferation regulators, and immunomodulatory proteins. IFN-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IFN-beta protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IFN-β protein is a type I interferon that plays a key role in the innate immune response by binding to IFNAR2 and IFNAR1 receptors and activating Jak-STAT signaling. This results in transcriptional regulation of interferon-regulated genes, affecting antiviral proteins, cell proliferation regulators, and immunomodulatory proteins. IFN-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IFN-beta protein, expressed by HEK293 , with C-hFc labeled tag.

Background

IFN-beta Protein, a type I interferon cytokine, assumes a pivotal role in the innate immune response to infections, tumors, and various inflammatory stimuli. Its signaling involves binding to the high-affinity receptor IFNAR2 and the low-affinity receptor IFNAR1, forming a heterodimeric complex and activating the canonical Jak-STAT signaling pathway. This activation results in the transcriptional modulation of interferon-regulated genes, encompassing antiviral proteins, regulators of cell proliferation and differentiation, and immunoregulatory proteins. While predominantly signaling through the IFNAR1-IFNAR2 heterodimeric receptor, IFN-beta can also function with IFNAR1 alone, operating independently of Jak-STAT pathways. IFN-beta elicits diverse responses, including antiviral and antibacterial activities, and influences B-cell development, myelopoiesis, and lipopolysaccharide (LPS)-inducible production of tumor necrosis factor. Beyond its immune functions, IFN-beta plays a crucial role in neuronal homeostasis by regulating dopamine turnover and protecting dopaminergic neurons, promoting neuronal autophagy, and facilitating alpha-synuclein clearance, thereby preventing dopaminergic neuron loss. Notably, IFN-beta demonstrates greater potency than interferon-alpha (IFN-alpha) in inducing apoptotic and antiproliferative pathways crucial for controlling tumor cell growth. It functions as a monomer in these regulatory processes.

Biological Activity

1. Measured in antiviral assay using L929 cells infected with vesicular stomatitisvirus (VSV) and the ED50 is typically 8 pg/mL.
2. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse IFNAR2 at 2 μg/mL (100 μL/well) can bind Biotinylated Recombinant Mouse IFNB1. The ED50 for this effect is 3.885 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse IFNAR2 at 2 μg/mL (100 μL/well) can bind Biotinylated Recombinant Mouse IFNB1. The ED50 for this effect is 3.885 ng/mL.
Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

P01575 (I22-N182)

Gene ID
Molecular Construction
N-term
IFN-beta (I22-N182)
Accession # P1575
hFc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interferon beta; IFN-beta; IFNB1; IFB; IFNB
AA Sequence

INYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN

Predicted Molecular Mass
46.7 kDa
Molecular Weight

Approximately 55-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Structure/Form
disulfide-linked homodimer
Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% tween 80.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IFN-beta Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IFN-beta Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-beta Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P73131
Quantity:
MCE Japan Authorized Agent: