Copy Link Print Information

IgE Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

IgE protein is an important immunoglobulin component that participates in the recognition and effector phases of humoral immunity. As a membrane-bound receptor on B lymphocytes, IgE triggers clonal expansion upon antigen binding, leading to plasma cell differentiation. IgE Protein, Human (HEK293, His) is the recombinant human-derived IgE protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IgE Protein, Human (HEK293, His)
  • Experimental Validation Results for IgE Protein, Human (HEK293, His)
  • Experimental Validation Results for IgE Protein, Human (HEK293, His)
  • IgE Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IgE protein is an important immunoglobulin component that participates in the recognition and effector phases of humoral immunity. As a membrane-bound receptor on B lymphocytes, IgE triggers clonal expansion upon antigen binding, leading to plasma cell differentiation. IgE Protein, Human (HEK293, His) is the recombinant human-derived IgE protein, expressed by HEK293 , with C-His labeled tag.

Background

The IgE protein, a crucial component of immunoglobulins, functions in both the recognition and effector phases of humoral immunity. Serving as a membrane-bound receptor on B lymphocytes during the recognition phase, IgE plays a pivotal role in triggering clonal expansion and differentiation into immunoglobulin-secreting plasma cells upon specific antigen binding. In the effector phase, secreted IgE mediates immune responses through two Fc receptors, FCER1A:MS4A2:FCGR1A and FCER2, which, upon antigen cross-linking, initiate signaling pathways leading to immune cell activation. IgE facilitates immediate hypersensitivity responses against allergens and defends against helminth parasites, bacteria, and venom toxicity. Dysregulation can lead to harmful allergic reactions and anaphylaxis. IgE stimulates mast cells, basophils, and eosinophils to release inflammatory mediators, contributing to tissue remodeling and cytotoxicity against microbes. On macrophages, IgE induces intracellular killing of parasites and activates antitumor functions, including antibody-dependent cytotoxicity and proinflammatory responses. Additionally, IgE plays a role in B cell antigen uptake and presentation to T cells.

Verified Bioactivity

1. Measured by its binding ability in a functional ELISA. When Recombinant Human IgE Protein is immobilized at 2 µg/mL (100 µL/well) can bind Biotinylated Human CD23 Protein. The ED50 for this effect is 0.5-3.5 μg/mL.
2. Loaded Ligelizumab (HY-P99300) on AHC2 biosensor, can bind IgE Protein, Human (HEK293, His) with an affinity constant of 1.089E-12 M as determined in BLI assay.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Human IgE Protein is immobilized at 2 µg/mL (100 µL/well) can bind Biotinylated Human CD23 Protein. The ED50 for this effect is 0.7468 μg/mL.

  • Bioactivity - BLI

    Bioactivity - BLI

    Loaded Ligelizumab (HY-P99300) on AHC2 biosensor, can bind IgE Protein, Human (HEK293, His) with an affinity constant of 1.089E-12 M as determined in BLI assay.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession

    AAB59395 (C208-K427)

  • Gene ID
    /
  • Molecular Construction
    • N-term
    • IgE (C208-K427)
      Accession # AAB59395
    • His
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    IGHE; Ig Epsilon Chain C Region; Immunoglobulin Heavy Constant Epsilon; Immunoglobulin Epsilon; Constant Region Of Heavy Chain Of IgE; IgE; Ig Epsilon Chain C Region ND

  • AA Sequence

    CADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPGK

  • Molecular Weight

    Approximately 32-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When Recombinant Human IgE Protein is immobilized at 2 µg/mL (100 µL/well) can bind Biotinylated Human CD23 Protein. The ED50 for this effect is 0.7468 μg/mL.

  • 1/16

    MedChemExpress Validation
     Loaded Ligelizumab (HY-P99300) on AHC2 biosensor, can bind IgE Protein, Human (HEK293, His) with an affinity constant of 1.089E-12 M as determined in BLI assay.

  • IgE Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for IgE Protein, Human (HEK293, His)
  • Experimental Validation Results for IgE Protein, Human (HEK293, His)
  • Experimental Validation Results for IgE Protein, Human (HEK293, His)
  • IgE Protein, Human (HEK293, His) Product Image