1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. IGF family
  4. IGFs
  5. IGF-I/IGF-1 Protein, Rat

IGF-I/IGF-1 Protein, Rat

Cat. No.: HY-P7203
Handling Instructions

IGF-I/IGF-1 Protein, Rat has somatomedin activity and ability to potently promote neuronal survival.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $70 In-stock
Estimated Time of Arrival: December 31
50 μg $140 In-stock
Estimated Time of Arrival: December 31
100 μg $220 Get quote
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE IGF-I/IGF-1 Protein, Rat

IGF-I/IGF-1 Protein, Rat Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Rat

Source

E. coli

Tag

Tag Free

Accession

P08025 (G49-A118)

Gene ID

24482

Synonyms
rRtIGF-I; Somatomedin C; IGF1; Mechano growth factor
AA Sequence

MGPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA

Molecular Weight

Approximately 7.8 kDa

Biological Activity
The ED50 is <10 ng/mL as measured by FDCP-1 cells, corresponding to a specific activity of >1.0 × 105 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

IGF-I (Insulin-like Growth Factor-I) has somatomedin activity. IGF-I stimulates the growth of hypophysectiomized rats in a dose-dependent manner[1]. Circulating IGF-I plays a prominent role in normal growth and development by mediating the indirect effects of growth hormone, with which it has a complex relationship. Delivery of IGF-I to the CNS may be beneficial in the treatment of Alzheimer’s disease or stroke because of IGF-I’s ability to potently promote neuronal survival, rescue hippocampal neurons from β-amyloid induced neurotoxicity, reduce tau phosphorylation, protect cortical neurons against nitric oxide-mediated neurotoxicity, rescue neurons from glucose deprivation and stimulate neurogenesis and synaptogenesis[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IGF-I/IGF-1 Protein, Rat
Cat. No.:
HY-P7203
Quantity:
MCE Japan Authorized Agent: