IGF-I/IGF-1 Protein, Rat
Based on 3 publication(s) in Google Scholar
IGF-I/IGF-1 Protein, Rat has somatomedin activity and ability to potently promote neuronal survival.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IGF-I/IGF-1 Protein, Rat has somatomedin activity and ability to potently promote neuronal survival.
Background
IGF-I (Insulin-like Growth Factor-I) has somatomedin activity. IGF-I stimulates the growth of hypophysectiomized rats in a dose-dependent manner[1]. Circulating IGF-I plays a prominent role in normal growth and development by mediating the indirect effects of growth hormone, with which it has a complex relationship. Delivery of IGF-I to the CNS may be beneficial in the treatment of Alzheimer’s disease or stroke because of IGF-I’s ability to potently promote neuronal survival, rescue hippocampal neurons from β-amyloid induced neurotoxicity, reduce tau phosphorylation, protect cortical neurons against nitric oxide-mediated neurotoxicity, rescue neurons from glucose deprivation and stimulate neurogenesis and synaptogenesis[2].
Verified Bioactivity
1.The ED50 is <10 ng/mL as measured by FDCP-1 cells, corresponding to a specific activity of >1.0 × 105 units/mg.
2.Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect is 8.742-9.473 ng/mL. corresponding to a specific activity is ≥1.05×105 units/mg.
Publications (3)
-
Journal Impact Factor
-
Most Recent
-
J Biol Chem
Downregulation of ClC-3 chloride channels in dorsal root ganglia neurons contributes to bone metastasis-induced pain. [Abstract]2026 Mar;302(3):111268. PMID: 41655695
IGF-I/IGF-1 Protein, Rat purchased from MedChemExpress. Usage Cited in: J Biol Chem. 2026 Mar;302(3):111268. [Abstract]
IGF-I/IGF-1 Protein, Rat (50 μL/kg; intrathecally; once per day for four consecutive days) increased the protein expression of p-AKT in L4/5 DRG tissues in rats.
IGF-I/IGF-1 Protein, Rat purchased from MedChemExpress. Usage Cited in: J Biol Chem. 2026 Mar;302(3):111268. [Abstract]
IGF-I/IGF-1 Protein, Rat (50 μL/kg; intrathecally; once per day for four consecutive days) increased the protein expression of HDAC2 in DRG tissues of naïve rats.
IGF-I/IGF-1 Protein, Rat purchased from MedChemExpress. Usage Cited in: J Biol Chem. 2026 Mar;302(3):111268. [Abstract]
IGF-I/IGF-1 Protein, Rat (50 μL/kg; intrathecally; once per day for four consecutive days) decreased mRNA and protein level of ClC-3 in the DRG neurons of naïve rats.
IGF-I/IGF-1 Protein, Rat purchased from MedChemExpress. Usage Cited in: J Biol Chem. 2026 Mar;302(3):111268. [Abstract]
IGF-I/IGF-1 Protein, Rat (50 μL/kg; intrathecally; once per day for four consecutive days) produced evident pain hypersensitivity that was assessed by the decreased PWT and PWL, the animal’s locomotor function was not impaired.
IGF-I/IGF-1 Protein, Rat purchased from MedChemExpress. Usage Cited in: J Biol Chem. 2026 Mar;302(3):111268. [Abstract]
in ipsilateral L4/5 DRG tissues obtained from IGF1-treated naïve rats that received intrathecal LV-shIGF1R and the control LV-GFP, respectively.
-
Am J Transl Res
MiR-199a-5p inhibition protects cognitive function of ischemic stroke rats by AKT signaling pathway. [Abstract]2020 Oct 15;12(10):6549-6558. PMID: 33194051 -
Environ Toxicol
The Increased Apoptosis of Mesenchymal Stem Cells Mediated Osteopenia Due to Prenatal Nicotine Exposure in Female Offspring Rats via IGF1 Pathway. [Abstract]2024 Nov;39(11):5199-5208. PMID: 39207236
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag Tag Free
-
Accession
P08025 (G49-A118)
-
Molecular Construction
-
N-term
-
IGF1 (G49-A118)
Accession # P08025 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IGF1; Somatomedin-C; Insulin Like Growth Factor 1; IGF1A; IGF-I; MGF; Insulin-Like Growth Factor 1; Insulin-Like Growth Factor IB; Insulin-Like Growth Factor I; Insulin-Like Growth Factor-I; IGFI; Alternative Protein IGF1; IGF; Somatomedin C; Insulin-Like
-
AA Sequence
GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA
-
Predicted Molecular Mass
7.7 kDa
-
Molecular Weight
Approximately 8 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Schoenle E, et al. Insulin-like growth factor I stimulates growth in hypophysectomized rats. Nature. 1982 Mar 18;296(5854):252-3. [Content Brief]
[2]. Thorne RG, et al. Delivery of insulin-like growth factor-I to the rat brain and spinal cord along olfactory and trigeminal pathways following intranasal administration. Neuroscience. 2004;127(2):481-96. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)