1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. IGF family
  4. IGFBP-7
  5. IGFBP-7 Protein, Mouse (HEK293, Fc)

IGFBP-7 Protein, Mouse (HEK293, Fc)

Cat. No.: HY-P74844
SDS COA Handling Instructions

IGFBP-7 Protein is a member of the insulin-like growth factor binding protein (IGFBP) Family. The major function of IGFBP-7 is the regulation of availability of insulin-like growth factors (IGFs) in tissue as well as in modulating IGF binding to its receptors. IGFBP7 exhibits a relatively low affinity for binding to both IGF-I and IGF-II. Furthermore, it has the capacity to stimulate the production of prostacyclin (PGI2) and enhance cell adhesion. IGFBP-7 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IGFBP-7 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of IGFBP-7 Protein, Mouse (HEK293, Fc) is 256 a.a., with molecular weight of ~53.3-60 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
5 μg $66 In-stock
10 μg $105 In-stock
50 μg $210 In-stock
100 μg $340 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IGFBP-7 Protein is a member of the insulin-like growth factor binding protein (IGFBP) Family. The major function of IGFBP-7 is the regulation of availability of insulin-like growth factors (IGFs) in tissue as well as in modulating IGF binding to its receptors. IGFBP7 exhibits a relatively low affinity for binding to both IGF-I and IGF-II. Furthermore, it has the capacity to stimulate the production of prostacyclin (PGI2) and enhance cell adhesion. IGFBP-7 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IGFBP-7 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of IGFBP-7 Protein, Mouse (HEK293, Fc) is 256 a.a., with molecular weight of ~53.3-60 kDa.

Background

Insulin-like growth factor binding protein 7 (IGFBP-7) is a member of the IGFBP Family. IGFBP-7 is high expressed in liver, kidney, bone and muscle, and the expression level is higher in renal tubules. IGFBP7 exhibits a relatively low affinity for binding to both IGF-I and IGF-II compared to IGFBPs 1-6. Furthermore, it has the capacity to stimulate the production of prostacyclin (PGI2) and enhance cell adhesion. IGFBP-7 interacts with Insulin-like growth factor 1, VPS24, and the IGF-1 receptor. Its wider distribution in normal tissue and lower expression in several cancer cells indicate that IGFBP-7 may function as a growth-suppressing factor, as well as an IGF-binding protein[1][2][3].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized mouse IGFBP-7 at 0.5 μg/mL (100 μL/well) can bind biotinylated CCL21. The ED50 for this effect is 8.153 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized mouse IGFBP-7 at 0.5 μg/mL (100μL/well) can bind biotinylated CCL21. The ED50 for this effect is 8.153 ng/mL.
Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

AAH92538.1 (S26-L281)

Gene ID
Molecular Construction
N-term
IGFBP-7 (S26-L281)
Accession # AAH92538.1
hFc
C-term
Synonyms
IBP-7; IGFBP7; IGFBP-7v; Insulin-like growth factor binding protein 7
AA Sequence

SSSDACGPCVPASCPALPRLGCPLGETRDACGCCPVCARGEGEPCGGGAAGRGHCAPGMECVKSRKRRKGKAGAAAGGPATLAVCVCKSRYPVCGSNGITYPSGCQLRAASLRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAKVFLSCEVIGIPTPVLIWNKVKRDHSGVQRTELLPGDRENLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASAAAKITVVDALHEIPLKKGEGAQL

Molecular Weight

Approximately 53.3-60 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IGFBP-7 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IGFBP-7 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P74844
Quantity:
MCE Japan Authorized Agent: