IGF2BP2 Protein, Human (T7-His)
Based on 1 Customer Validation
The IGF2BP2 protein is an RNA-binding factor that coordinates the recruitment of target transcripts into cytoplasmic mRNP, promoting mRNA transport and transient storage. It regulates the contact of target transcripts with the translation machinery and protects them from microRNA-mediated degradation. IGF2BP2 Protein, Human (T7-His) is the recombinant human-derived IGF2BP2 protein, expressed by E. coli , with N-T7, C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The IGF2BP2 protein is an RNA-binding factor that coordinates the recruitment of target transcripts into cytoplasmic mRNP, promoting mRNA transport and transient storage. It regulates the contact of target transcripts with the translation machinery and protects them from microRNA-mediated degradation. IGF2BP2 Protein, Human (T7-His) is the recombinant human-derived IGF2BP2 protein, expressed by E. coli , with N-T7, C-6*His labeled tag.
Background
The IGF2BP2 protein functions as an RNA-binding factor, orchestrating the recruitment of target transcripts into cytoplasmic protein-RNA complexes (mRNPs). This 'caging' of transcripts within mRNPs facilitates mRNA transport and transient storage while modulating the rate and location of target transcripts encountering the translational apparatus. Moreover, IGF2BP2 shields these transcripts from endonuclease attacks or degradation mediated by microRNAs. With a preference for N6-methyladenosine (m6A)-containing mRNAs, IGF2BP2 enhances their stability. It exhibits specific binding to the 5'-UTR of insulin-like growth factor 2 (IGF2) mRNAs and selectively binds to transcripts like beta-actin/ACTB and MYC, increasing MYC mRNA stability through interaction with the coding region instability determinant (CRD). IGF2BP2 can form homooligomers and heterooligomers with IGF2BP1 and IGF2BP3 in an RNA-dependent manner and interacts with various proteins, including HNRPD, IGF2BP1, ELAVL1, DHX9, HNRNPU, MATR3, and PABPC1. Its interaction with the HOXB-AS3 peptide further enhances MYC stability.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-T7;C-6*His
-
Accession
Q9Y6M1-2 (M1-T220)
-
Molecular Construction
-
N-term
-
T7
-
IGF2BP2 (M1-T220)
Accession # Q9Y6M-2 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
IGF2BP2; VICKZ2; Insulin Like Growth Factor 2 MRNA Binding Protein 2; IMP2; IMP-2; P62; Insulin-Like Growth Factor 2 MRNA-Binding Protein 2; Truncated Insulin-Like 2 Growth Factor 2-Binding Protein 2; IGF-II MRNA-Binding Protein 2; Insulin-Like Growth Fac
-
AA Sequence
MMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNIT
-
Predicted Molecular Mass
27.2 kDa
-
Molecular Weight
Approximately 29 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 15% trehalose, 150mM
NaCl, 0.1% Tween80, pH 8.5.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)