1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. IGF family
  4. IGFBP-2
  5. IGF2BP2 Protein, Human (T7-His)

IGF2BP2 Protein, Human (T7-His)

Cat. No.: HY-P70950
COA Handling Instructions

The IGF2BP2 protein is an RNA-binding factor that coordinates the recruitment of target transcripts into cytoplasmic mRNP, promoting mRNA transport and transient storage. It regulates the contact of target transcripts with the translation machinery and protects them from microRNA-mediated degradation. IGF2BP2 Protein, Human (T7-His) is the recombinant human-derived IGF2BP2 protein, expressed by E. coli , with N-T7, C-6*His labeled tag. The total length of IGF2BP2 Protein, Human (T7-His) is 220 a.a., with molecular weight of ~43.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $170 In-stock
50 μg $510 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IGF2BP2 protein is an RNA-binding factor that coordinates the recruitment of target transcripts into cytoplasmic mRNP, promoting mRNA transport and transient storage. It regulates the contact of target transcripts with the translation machinery and protects them from microRNA-mediated degradation. IGF2BP2 Protein, Human (T7-His) is the recombinant human-derived IGF2BP2 protein, expressed by E. coli , with N-T7, C-6*His labeled tag. The total length of IGF2BP2 Protein, Human (T7-His) is 220 a.a., with molecular weight of ~43.0 kDa.

Background

The IGF2BP2 protein functions as an RNA-binding factor, orchestrating the recruitment of target transcripts into cytoplasmic protein-RNA complexes (mRNPs). This 'caging' of transcripts within mRNPs facilitates mRNA transport and transient storage while modulating the rate and location of target transcripts encountering the translational apparatus. Moreover, IGF2BP2 shields these transcripts from endonuclease attacks or degradation mediated by microRNAs. With a preference for N6-methyladenosine (m6A)-containing mRNAs, IGF2BP2 enhances their stability. It exhibits specific binding to the 5'-UTR of insulin-like growth factor 2 (IGF2) mRNAs and selectively binds to transcripts like beta-actin/ACTB and MYC, increasing MYC mRNA stability through interaction with the coding region instability determinant (CRD). IGF2BP2 can form homooligomers and heterooligomers with IGF2BP1 and IGF2BP3 in an RNA-dependent manner and interacts with various proteins, including HNRPD, IGF2BP1, ELAVL1, DHX9, HNRNPU, MATR3, and PABPC1. Its interaction with the HOXB-AS3 peptide further enhances MYC stability.

Species

Human

Source

E. coli

Tag

N-T7;C-6*His

Accession

Q9Y6M1 (M1-T220)

Gene ID
Molecular Construction
N-term
T7
IGF2BP2 (M1-T220)
Accession # Q9Y6M1
6*His
C-term
Synonyms
Insulin-Like Growth Factor 2 mRNA-Binding Protein 2; IGF2 mRNA-Binding Protein 2; IMP-2; Hepatocellular Carcinoma Autoantigen p62; IGF-II mRNA-Binding Protein 2; VICKZ Family Member 2; IGF2BP2; IMP2; VICKZ2
AA Sequence

MMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNIT

Molecular Weight

Approximately 43.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

IGF2BP2 Protein, Human (T7-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IGF2BP2 Protein, Human (T7-His)
Cat. No.:
HY-P70950
Quantity:
MCE Japan Authorized Agent: