IHH Protein, Human

IHH Protein, Human is involved in chondrocyte differentiation, proliferation and maturation especially during endochondral ossification.

Indian hedgehog (Ihh), which encodes amember of the Hedgehog family of signaling factors, is initially expressed in chondrocytes of the early cartilaginous skeletal elements^[1]. Indian Hedgehog is an antagonist of Wnt signaling in colonic epithelial cell differentiation^[2]. Ihh is involved in chondrocyte differentiation, proliferation and maturation especially during endochondral ossification. It regulates its effects by feedback control of parathyroid hormone-related peptide (PTHrP) ^[3].

1.The ED₅₀ is <3 μg/mL as measured by its ability to induce alkaline phosphatase production by CCL-226 cells.
2.Measured by its ability to induce alkaline phosphatase production by C3H10T1/2 fibroblasts. The ED₅₀ for this effect is typically 5.587 μg/mL, corresponding to a specific activity is 179.0 units/mg.

Human

E. coli

Tag Free

Q14623 (G29-G202)

3549  [NCBI]

GPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG

Approximately 20 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Van den Brink GR, et al. Indian Hedgehog is an antagonist of Wnt signaling in colonic epithelial cell differentiation. Nat Genet. 2004 Mar;36(3):277-82. Epub 2004 Feb 8.  [Content Brief]

  [2]. St-Jacques B, et al. Indian hedgehog signaling regulates proliferation and differentiation of chondrocytes and is essential for bone formation. Genes Dev. 1999 Aug 15;13(16):2072-86.  [Content Brief]

  [3]. Vortkamp A, et al. Regulation of rate of cartilage differentiation by Indian hedgehog and PTH-related protein. Science. 1996 Aug 2;273(5275):613-22.  [Content Brief]