IL-10 Protein, Mouse (CHO)

IL-10 Protein, Mouse (CHO) is a potent CHO cell derived anti-inflammatory cytokine results in increased immune-mediated demyelination in mice infected with a neurotropic coronavirus.

The anti-inflammatory cytokine interleukin-10 (IL-10) is a pleiotropic cytokine that is produced in abundant quantities during most parasitic, bacterial, viral, and fungal diseases. IL-10 functions by dampening the innate or very early T cell immune response. Treatment with IL-10 may be useful adjunct therapy in some types of viral encephalitis. IL-10 primarily acts to suppress macrophages and dendritic cell (DC) function by inhibiting expression of major histocompatibility complex (MHC) class II and costimulatory molecules such as CD80/CD86 and production of proinflammatory cytokines and chemokines, including IL-12. IL-10 also has direct effects on T cells, inhibiting activation and cytokine expression. Production of IL-10 by highly activated virus-specific T cells raises the possibility that IL-10 functions via both autocrine and paracrine signaling to limit inflammation during acute phases of the disease^[1].

1.The ED₅₀ is <0.2 ng/mL as measured by MC/9 cells.
2.Mouse IL-10 inhibits LPS-induced secretion of IL-6 by RAW264.7 cells. The ED₅₀ for this effect is 0.2642 ng/mL.Corresponding to a specific activity is 3.785×10⁶ U/mg.

• 
  Mouse IL-10 inhibits LPS-induced secretion of IL-6 by RAW264.7 cells. The ED₅₀ for this effect is 0.2642 ng/mL.Corresponding to a specific activity is 3.785×10⁶ U/mg.

Mouse

CHO

Tag Free

P18893 (S19-S178)

16153  [NCBI]

Full Length of Mature Protein

SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Approximately 20-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5-7.4.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Trandem K, et al. Virally expressed interleukin-10 ameliorates acute encephalomyelitis and chronic demyelinationin coronavirus-infected mice. J Virol. 2011 Jul;85(14):6822-31.  [Content Brief]