IL-10 Protein, Mouse (CHO)
Based on 1 Customer Validation
IL-10 Protein, Mouse (CHO) is a potent CHO cell derived anti-inflammatory cytokine results in increased immune-mediated demyelination in mice infected with a neurotropic coronavirus.
- Species: Mouse
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
IL-10 Protein, Mouse (CHO) is a potent CHO cell derived anti-inflammatory cytokine results in increased immune-mediated demyelination in mice infected with a neurotropic coronavirus.
The anti-inflammatory cytokine interleukin-10 (IL-10) is a pleiotropic cytokine that is produced in abundant quantities during most parasitic, bacterial, viral, and fungal diseases. IL-10 functions by dampening the innate or very early T cell immune response. Treatment with IL-10 may be useful adjunct therapy in some types of viral encephalitis. IL-10 primarily acts to suppress macrophages and dendritic cell (DC) function by inhibiting expression of major histocompatibility complex (MHC) class II and costimulatory molecules such as CD80/CD86 and production of proinflammatory cytokines and chemokines, including IL-12. IL-10 also has direct effects on T cells, inhibiting activation and cytokine expression. Production of IL-10 by highly activated virus-specific T cells raises the possibility that IL-10 functions via both autocrine and paracrine signaling to limit inflammation during acute phases of the disease[1].
1.The ED50 is <0.2 ng/mL as measured by MC/9 cells.
2.Mouse IL-10 inhibits LPS-induced secretion of IL-6 by RAW264.7 cells. The ED50 for this effect is 0.2642 ng/mL.Corresponding to a specific activity is 3.785×106 U/mg.
Technical Parameters
-
Species Mouse
-
Source CHO
-
Tag Tag Free
-
Accession
P18893 (S19-S178)
-
Molecular Construction
-
N-term
-
IL-10 (S19-S178)
Accession # P18893 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL10; TGIF; Interleukin 10; T-Cell Growth Inhibitory Factor; IL-10; Interleukin-10; CSIF; Interleukin Family Protein; Cytokine Synthesis Inhibitory Factor; GVHDS; IL10A; IF2A
-
AA Sequence
SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS
-
Predicted Molecular Mass
18.8 kDa
-
Molecular Weight
Approximately 21-23 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5-7.4.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
