1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-11
  5. IL-11 Protein, Cynomolgus (HEK293, His)

IL-11 protein is a potent cytokine that significantly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, leading to megakaryocyte maturation and platelet production. It also promotes hepatocyte proliferation in response to liver injury. IL-11 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-11 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-11 protein is a potent cytokine that significantly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, leading to megakaryocyte maturation and platelet production. It also promotes hepatocyte proliferation in response to liver injury. IL-11 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-11 protein, expressed by HEK293 , with N-His labeled tag.

Background

IL-11 Protein is a potent cytokine that plays a crucial role in stimulating the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, leading to the maturation of megakaryocytes and subsequent production of platelets. Additionally, IL-11 Protein facilitates the proliferation of hepatocytes in response to liver damage. Upon binding to its receptor, composed of IL6ST and IL11RA, IL-11 Protein triggers a signaling cascade that promotes cell proliferation. This signaling cascade involves the activation of intracellular protein kinases and the phosphorylation of STAT3. IL-11 Protein can engage in two types of signaling: 'classic signaling' occurs through the interaction with membrane-bound IL11RA and IL6ST, while 'trans-signaling' is induced by the binding of IL-11 and soluble IL11RA to IL6ST. Furthermore, IL-11 Protein interacts with IL11RA to form a multimeric signaling complex in association with IL6ST.

Species

Cynomolgus

Source

HEK293

Tag

N-8*His

Accession

P20808 (P22-L199)

Gene ID
Molecular Construction
N-term
8*His
IL-11 (P22-L199)
Accession # P20808
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin-11; IL11; Adipogenesis inhibitory factor; AGIF; INN: Oprelvekin; Oprelvekin; IL-11Oprelvekin; interleukin 11; interleukin-11
AA Sequence

PGPPPGSPRASPDPRAELDSTVLLTRSLLEDTRQLTIQLKDKFPADGDHNLDSLPTLAMSAGALGALQLPSVLTRLRADLLSYLRHVQWLRRAMGSSLKTLEPELGTLQTRLDRLLRRLQLLMSRLALPQLPPDPPAPPLAPPSSTWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Predicted Molecular Mass
20.5 kDa
Molecular Weight

Approximately 21-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

IL-11 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-11 Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-11 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P701007
Quantity:
MCE Japan Authorized Agent: