IL-11 Protein, Cynomolgus
Based on 1 Customer Validation
IL-11 protein is a potent cytokine that significantly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, leading to megakaryocyte maturation and platelet production. It also promotes hepatocyte proliferation in response to liver injury. IL-11 Protein, Cynomolgus is the recombinant cynomolgus-derived IL-11 protein, expressed by E. coli , with tag free.
- Species: Cynomolgus
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-11 protein is a potent cytokine that significantly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, leading to megakaryocyte maturation and platelet production. It also promotes hepatocyte proliferation in response to liver injury. IL-11 Protein, Cynomolgus is the recombinant cynomolgus-derived IL-11 protein, expressed by E. coli , with tag free.
Background
IL-11 Protein is a potent cytokine that plays a crucial role in stimulating the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, leading to the maturation of megakaryocytes and subsequent production of platelets. Additionally, IL-11 Protein facilitates the proliferation of hepatocytes in response to liver damage. Upon binding to its receptor, composed of IL6ST and IL11RA, IL-11 Protein triggers a signaling cascade that promotes cell proliferation. This signaling cascade involves the activation of intracellular protein kinases and the phosphorylation of STAT3. IL-11 Protein can engage in two types of signaling: 'classic signaling' occurs through the interaction with membrane-bound IL11RA and IL6ST, while 'trans-signaling' is induced by the binding of IL-11 and soluble IL11RA to IL6ST. Furthermore, IL-11 Protein interacts with IL11RA to form a multimeric signaling complex in association with IL6ST.
Verified Bioactivity
Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 4.216 ng/mL, corresponding to a specific activity is 2.371×105 units/mg.
Technical Parameters
-
Species Cynomolgus
-
Source E. coli
-
Tag Tag Free
-
Accession
P20808/XP_005595839.2 (P22-L199)
-
Gene ID102128313
-
Molecular Construction
-
N-term
-
IL-11 (P22-L199)
Accession # P20808 -
C-term
-
-
Protein Length
Full Length of Interleukin-11 Chain
-
Synonyms
IL11; Adipogenesis Inhibitory Factor; Interleukin 11; Interleukin-11; IL-11; Oprelvekin; AGIF
-
AA Sequence
PGPPPGSPRASPDPRAELDSTVLLTRSLLEDTRQLTIQLKDKFPADGDHNLDSLPTLAMSAGALGALQLPSVLTRLRADLLSYLRHVQWLRRAMGSSLKTLEPELGTLQTRLDRLLRRLQLLMSRLALPQLPPDPPAPPLAPPSSTWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
-
Predicted Molecular Mass
19.4 kDa
-
Molecular Weight
Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
