IL-11 Protein, Mouse (HEK293)

IL-11 Protein, Mouse (HEK293) is a HEK293 cell derived pleiotropic cytokine that regulates cell cycle, invasion, and migration in numerous cell types.

Interleukin-11 (IL-11) is a pleiotropic cytokine that regulates cell cycle, invasion, and migration in numerous cell types, all roles critical to placental development. IL-11 is a member of the IL-6-type cytokines and signals via the IL11 receptor (R) α chain and signal transducer gp130 to activate the Janus kinase (JAK)/Signal transducers and activators of transcription (STAT)3 pathway in human endometrium and primary human extravillous trophoblast (EVT) . IL-11 is required for decidualization in humans and mice. IL11 levels are elevated in preeclampsia (PE) decidual tissue. L-11 has multiple effects on both hematopoietic and nonhematopoietic cells. Many of the biological effects described for IL-11 overlap those for IL-6. In vitro, IL-11 can synergize with IL-3, IL-4 and SCF to shorten the G₀ period of early hematopoietic progenitors. IL-11 also enhances the IL-3-dependent megakaryocyte colony formation. IL-11 has been found to stimulate the T cell dependent development of specific immunoglobulin-secreting B cell^[1].

The ED₅₀ is <3 ng/mL as measured by T11 cells.

Mouse

HEK293

Tag Free

P47873 (G23-L199)

16156  [NCBI]

GPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

21-23 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Winship AL, et al. Interleukin-11 alters placentation and causes preeclampsia features in mice. Proc Natl Acad Sci U S A. 2015 Dec 29;112(52):15928-33.  [Content Brief]