1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-12 IL-23
  5. IL-12 beta
  6. IL-12 beta Protein, Cynomolgus (HEK293, His)

IL-12 beta Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P701009
Handling Instructions Technical Support

IL-12 beta protein binds to IL23A to produce the cytokine IL-23, which is critical for innate and adaptive immunity. IL-23, together with IL-17, orchestrates immediate infection responses in peripheral tissues. IL-12 beta Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-12 beta protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-12 beta protein binds to IL23A to produce the cytokine IL-23, which is critical for innate and adaptive immunity. IL-23, together with IL-17, orchestrates immediate infection responses in peripheral tissues. IL-12 beta Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-12 beta protein, expressed by HEK293 , with C-His labeled tag.

Background

The IL-12 beta Protein partners with IL23A, forming the IL-23 interleukin, a heterodimeric cytokine with essential functions in both innate and adaptive immunity. In conjunction with IL-17, IL-23 may orchestrate an immediate response to infection in peripheral tissues. Through binding to a heterodimeric receptor complex comprising IL12RB1 and IL23R, IL-23 initiates the Jak-Stat signaling cascade, preferentially stimulating memory T-cells over naive T-cells, and fostering the production of pro-inflammatory cytokines. Implicated in the induction of autoimmune inflammation, IL-23 may play a crucial role in autoimmune inflammatory diseases and tumorigenesis. Additionally, this cytokine acts as a growth factor for activated T and NK cells, amplifies the lytic activity of NK/lymphokine-activated killer cells, and triggers the production of IFN-gamma by resting PBMC.

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

A0A2K5TM36 (I23-S328)

Gene ID

102124858

Molecular Construction
N-term
IL-12β (I23-S328)
Accession # A0A2K5TM36
8*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
IL-12B; CLMF p40; IL-12 subunit p40; NKSF2; CLMF; CLMF2; NKS
AA Sequence

IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSGEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSHSLLLLHKKEDGIWSTDVLKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSNPQGVTCGAVTLSAERVRGDNKEYEYSVECQEDSACPAAEERLPIEVMVDAIHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCIQVQGKSKREKKDRIFTDKTSATVICRKNASFSVQAQDRYYSSSWSEWASVPCS

Predicted Molecular Mass
35.9 kDa
Molecular Weight

Approximately 40-50 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-12 beta Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-12 beta Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P701009
Quantity:
MCE Japan Authorized Agent: