IL-16 Protein, Mouse (His)
Based on 1 Customer Validation
IL-16 Protein, a cytokine, plays a significant role in immune regulation and inflammation. It modulates the activation and migration of various immune cells, such as T cells and monocytes. Understanding the functions of IL-16 Protein can aid in studying immune responses and developing targeted therapies for inflammatory and autoimmune diseases. IL-16 Protein, Mouse (His) is the recombinant mouse-derived IL-16 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
IL-16 Protein, a cytokine, plays a significant role in immune regulation and inflammation. It modulates the activation and migration of various immune cells, such as T cells and monocytes. Understanding the functions of IL-16 Protein can aid in studying immune responses and developing targeted therapies for inflammatory and autoimmune diseases. IL-16 Protein, Mouse (His) is the recombinant mouse-derived IL-16 protein, expressed by E. coli , with N-6*His labeled tag.
IL-16, a multifaceted protein, instigates a migratory response in CD4+ lymphocytes, monocytes, and eosinophils. It plays a pivotal role in priming CD4+ T-cells for responsiveness to interleukin-2 (IL-2) and interleukin-15 (IL-15), concurrently inducing the expression of the interleukin 2 receptor. Additionally, IL-16 serves as a ligand for CD4, fostering intricate interactions. Notably, isoform 1 of IL-16 is proposed to function as a scaffolding protein, providing a structural anchor for ion channels within the cellular membrane.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
O54824 (S1205-S1322)
-
Molecular Construction
-
N-term
-
6*His
-
IL-16 (S1205-S1322)
Accession # O54824 -
C-term
-
-
Protein Length
Partial
-
Synonyms
IL16; FLJ42735; Interleukin 16; FLJ16806; Pro-Interleukin-16; IL-16; PrIL-16; Interleukin 16 (Lymphocyte Chemoattractant Factor); LCF; Neuronal Interleukin 16; Lymphocyte Chemoattractant Factor; IL16 Protein; Prointerleukin 16; PRIL16; HsT19289; NIL16
-
AA Sequence
SAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS
-
Predicted Molecular Mass
14.5 kDa
-
Molecular Weight
Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris,150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
