1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-16
  5. IL-16 Protein, Mouse (His)

IL-16 Protein, Mouse (His)

Cat. No.: HY-P72590
SDS COA Handling Instructions

IL-16 Protein, a cytokine, plays a significant role in immune regulation and inflammation. It modulates the activation and migration of various immune cells, such as T cells and monocytes. Understanding the functions of IL-16 Protein can aid in studying immune responses and developing targeted therapies for inflammatory and autoimmune diseases. IL-16 Protein, Mouse (His) is the recombinant mouse-derived IL-16 protein, expressed by E. coli , with N-6*His labeled tag. The total length of IL-16 Protein, Mouse (His) is 118 a.a., with molecular weight of 14-16 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $168 In-stock
50 μg $504 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-16 Protein, a cytokine, plays a significant role in immune regulation and inflammation. It modulates the activation and migration of various immune cells, such as T cells and monocytes. Understanding the functions of IL-16 Protein can aid in studying immune responses and developing targeted therapies for inflammatory and autoimmune diseases. IL-16 Protein, Mouse (His) is the recombinant mouse-derived IL-16 protein, expressed by E. coli , with N-6*His labeled tag. The total length of IL-16 Protein, Mouse (His) is 118 a.a., with molecular weight of 14-16 kDa.

Background

IL-16, a multifaceted protein, instigates a migratory response in CD4+ lymphocytes, monocytes, and eosinophils. It plays a pivotal role in priming CD4+ T-cells for responsiveness to interleukin-2 (IL-2) and interleukin-15 (IL-15), concurrently inducing the expression of the interleukin 2 receptor. Additionally, IL-16 serves as a ligand for CD4, fostering intricate interactions. Notably, isoform 1 of IL-16 is proposed to function as a scaffolding protein, providing a structural anchor for ion channels within the cellular membrane.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

O54824 (S1205-S1322)

Gene ID
Molecular Construction
N-term
6*His
IL-16 (S1205-S1322)
Accession # O54824
C-term
Synonyms
Pro-interleukin-16; Interleukin-16; IL-16; Lymphocyte chemoattractant factor; LCF
AA Sequence

SAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS

Molecular Weight

14-16 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris,150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-16 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-16 Protein, Mouse (His)
Cat. No.:
HY-P72590
Quantity:
MCE Japan Authorized Agent: