1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. Interleukin & Receptors
  4. IL-18BP
  5. IL-18BP Protein, Cynomolgus (Biotinylated, HEK293, His)

IL-18BP Protein, Cynomolgus (Biotinylated, HEK293, His)

Cat. No.: HY-P701010
Handling Instructions Technical Support

The IL-18BP protein is an inhibitor of IL-18, which binds to IL-18 and prevents IL-18 from binding to its receptor, thereby inhibiting IL-18-induced IFN-γ production. IL-18BP protein is constitutively expressed and secreted in monocytes. IFN-γ can enhance the expression of this protein. IL-18BP Protein, Cynomolgus (Biotinylated, HEK293, His) is the recombinant cynomolgus-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

The IL-18BP protein is an inhibitor of IL-18, which binds to IL-18 and prevents IL-18 from binding to its receptor, thereby inhibiting IL-18-induced IFN-γ production. IL-18BP protein is constitutively expressed and secreted in monocytes. IFN-γ can enhance the expression of this protein. IL-18BP Protein, Cynomolgus (Biotinylated, HEK293, His) is the recombinant cynomolgus-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.

Background

Interleukin-18 is an interferon (IFN-γ) inducer and a member of the interleukin-1 (IL-1) cytokine family. IL-1 cytokines and their receptors are involved in inflammation, fever, and immune stimulation. IL-18 binding protein is an inhibitor of IL-18, which binds to IL-18 and prevents IL-18 from binding to its receptor, thereby inhibiting IL-18-induced IFN-γ production. IL-18 binding protein is constitutively expressed and secreted in monocytes. IFN-γ can enhance the expression of this protein[1][2].

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

A0A2K5UDJ4 (T28-P207)

Gene ID
Molecular Construction
N-term
IL-18BP (T28-P207)
Accession # A0A2K5UDJ4
8*His
C-term
Protein Length

Full Length of Mature Protein

Conjugation

Biotin

Synonyms
IL-18BP; Igifbp; Interleukin-18-binding protein
AA Sequence

TPVSQTTTAATASSRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEMPLNGTLTLSCTACSRFPNFSMLYWLGNGSFIEHLPGQLWEGSTSREHGSTGTRLYKALVLEQLTPALHSTNFSCVLMDPEQVVQRHVILAQLWAGLRTTLPPTQEALPSSHSTGPQQPTAAGLRLSTGPAAARP

Predicted Molecular Mass
21.1 kDa
Molecular Weight

Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

IL-18BP Protein, Cynomolgus (Biotinylated, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-18BP Protein, Cynomolgus (Biotinylated, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-18BP Protein, Cynomolgus (Biotinylated, HEK293, His)
Cat. No.:
HY-P701010
Quantity:
MCE Japan Authorized Agent: