1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. Interleukin & Receptors
  4. IL-18BP
  5. IL-18BP Protein, Cynomolgus (Biotinylated, HEK293, His)

IL-18BP Protein, Cynomolgus (Biotinylated, HEK293, His)

Cat. No.: HY-P701010
Handling Instructions Technical Support

The IL-18BP protein is an inhibitor of IL-18, which binds to IL-18 and prevents IL-18 from binding to its receptor, thereby inhibiting IL-18-induced IFN-γ production. IL-18BP protein is constitutively expressed and secreted in monocytes. IFN-γ can enhance the expression of this protein. IL-18BP Protein, Cynomolgus (Biotinylated, HEK293, His) is the recombinant cynomolgus-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

The IL-18BP protein is an inhibitor of IL-18, which binds to IL-18 and prevents IL-18 from binding to its receptor, thereby inhibiting IL-18-induced IFN-γ production. IL-18BP protein is constitutively expressed and secreted in monocytes. IFN-γ can enhance the expression of this protein. IL-18BP Protein, Cynomolgus (Biotinylated, HEK293, His) is the recombinant cynomolgus-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.

Background

Interleukin-18 is an interferon (IFN-γ) inducer and a member of the interleukin-1 (IL-1) cytokine family. IL-1 cytokines and their receptors are involved in inflammation, fever, and immune stimulation. IL-18 binding protein is an inhibitor of IL-18, which binds to IL-18 and prevents IL-18 from binding to its receptor, thereby inhibiting IL-18-induced IFN-γ production. IL-18 binding protein is constitutively expressed and secreted in monocytes. IFN-γ can enhance the expression of this protein[1][2].

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

A0A2K5UDJ4 (T28-P207)

Gene ID
Molecular Construction
N-term
IL-18BP (T28-P207)
Accession # A0A2K5UDJ4
8*His
C-term
Protein Length

Full Length of Mature Protein

Conjugation

Biotin

Synonyms
IL-18BP; Igifbp; Interleukin-18-binding protein
AA Sequence

TPVSQTTTAATASSRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEMPLNGTLTLSCTACSRFPNFSMLYWLGNGSFIEHLPGQLWEGSTSREHGSTGTRLYKALVLEQLTPALHSTNFSCVLMDPEQVVQRHVILAQLWAGLRTTLPPTQEALPSSHSTGPQQPTAAGLRLSTGPAAARP

Predicted Molecular Mass
21.1 kDa
분자량

Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
References

IL-18BP Protein, Cynomolgus (Biotinylated, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

IL-18BP Protein, Cynomolgus (Biotinylated, HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
IL-18BP Protein, Cynomolgus (Biotinylated, HEK293, His)
Cat. No.:
HY-P701010
수량:
MCE Japan Authorized Agent: