IL-18BP Protein, Human (CHO)

IL-18BP Protein, Human (CHO) Binding Protein (CHO-expressed) is a modulator of the Th1 cytokine response.

IL18BP (Interleukin-18 Binding Protein) is an early signal in the development of T-lympho-cyte helper type 1 (Th1) responses^[1]. IL18BP shares many characteristics with soluble cytokine receptors of the IL1 family in that the protein exhibits specificity for IL18, belongs to the immunoglobulin-like class of receptors and has limited amino acid sequences with those of the IL1 receptor type II. IL18BP suppresses the production of IFNγ resulting in reduced T-helper type 1 immune responses. Two human IL18BP isoforms exhibit the greatest affinity for IL18 with a rapid on-rate, a slow off-rate and a dissociation constant (kDa) of 399 pM. The two other isoforms with an incomplete immunoglobulin domain are unable to neutralise IL18^[2].

The ED₅₀ is <30 ng/mL as measured by KG-1 cells.

Human

CHO

Tag Free

O95998-2 (T31-G194)

10068  [NCBI]

TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG

42-44 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Novick D, et al. Interleukin-18 binding protein: a novel modulator of the Th1 cytokine response. Immunity. 1999 Jan;10(1):127-36.  [Content Brief]

  [2]. C. Dinarello, et al. Targeting interleukin 18 with interleukin 18 binding protein. Ann Rheum Dis. 2000 Nov; 59(Suppl 1): i17–i20.