IL-1F10/IL-38 Protein, Mouse (His-SUMO)

IL-1F10/IL-38 proteins regulate immune responses. IL-1F10/IL-38 Protein, Mouse (His-SUMO) is the recombinant mouse-derived IL-1F10/IL-38 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of IL-1F10/IL-38 Protein, Mouse (His-SUMO) is 152 a.a., with molecular weight of ~35 kDa.

IL-1F10/IL-38 Protein, exhibiting immunomodulatory activity, operates by influencing cytokine production. While it does not independently induce cytokine production, it plays a regulatory role in the immune response. Notably, IL-1F10/IL-38 reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans, indicating its ability to modulate specific immune pathways. Moreover, it diminishes IL36G-induced production of IL8 by peripheral blood mononuclear cells, highlighting its broader impact on cytokine responses. Conversely, IL-1F10/IL-38 increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS), suggesting its involvement in diverse immune processes. Functioning as a ligand for IL-36R/IL1RL2, IL-1F10/IL-38 engages in intricate interactions, and its binding with the cargo receptor TMED10 facilitates translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC), leading to subsequent secretion.

Mouse

E. coli

N-SUMO;N-6*His

Q8R459 (M1-R152)

215274  [NCBI]

MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR

Approximately 35 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.