IL-1RA/IL-1RN Protein, Human (HEK293)
Based on 2 publication(s) in Google Scholar
IL-1RA/IL-1RN Protein, Human (HEK293) is a member of the IL-1 family that binds to IL-1 receptors.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IL-1RA/IL-1RN Protein, Human (HEK293) is a member of the IL-1 family that binds to IL-1 receptors.
Background
The production of Human Interleukin-1 Receptor Antagonist Protein (IL-1ra) is stimulated by many substances including adherent IgG, other cytokines, and bacterial or viral components. Endogenous IL-1Ra is produced in numerous experimental animal models of disease as well as in human autoimmune and chronic inflammatory diseases. Treatment of human diseases with recombinant human IL-1Ra shows an absence of benefit in sepsis syndrome[1].
IL-1 receptor antagonist (IL-1ra) has provided a tool for blocking IL-1 activity in vivo, leading to a detailed understanding of the role of this cytokine in the inflammatory response[2].
Verified Bioactivity
1.The ED50 is <0.1 μg /mL as measured by D10S cells in the presence of 50.0 pg/mL Human IL-1a.
2.Measured by its ability to inhibit IL-1 alpha -dependent proliferation in CTLL-2 mouse cytotoxic T cells.The ED50 for this effect is 70.48 ng/mL in the presence of 50 pg/mL of rhIL-1 alpha, corresponding to a
specific activity is 1.419×104 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
J Neuroinflammation
The role of Toll-like receptor 4 in apoptosis of brain tissue after induction of intracerebral hemorrhage. [Abstract]2019 Nov 26;16(1):234. PMID: 31771613 -
Cell Rep
Expression of miRNA-29 in Pancreatic β Cells Promotes Inflammation and Diabetes via TRAF3. [Abstract]2021 Jan 5;34(1):108576. PMID: 33406428
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P18510-1 (R26-E177)
-
Molecular Construction
-
N-term
-
IL-1RA (R26-E177)
Accession # P18510-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
IL1RN; IL-1ra; Interleukin 1 Receptor Antagonist; Intracellular Interleukin-1 Receptor Antagonist (IcIL-1ra); ICIL-1RA; Intracellular Interleukin-1 Receptor Antagonist; IL-1RN; Intracellular IL-1 Receptor Antagonist Type II; IL1RA; Type II Interleukin-1 R
-
AA Sequence
RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
-
Molecular Weight
Approximately 21 kDa & 23 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
[1]. Arend WP, et al. Interleukin-1 receptor antagonist: role in biology. Annu Rev Immunol. 1998;16:27-55. [Content Brief]
[2]. Nikolic-Paterson DJ, et al. Interleukin-1 receptor antagonism. Semin Nephrol. 1996 Nov;16(6):583-90. [Content Brief]
[3]. Arend WP, et al. Interleukin 1 receptor antagonist. A new member of the interleukin 1 family. J Clin Invest. 1991 Nov;88(5):1445-51. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
