1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-1RA
  5. IL-1RA/IL-1RN Protein, Human (HEK293)

IL-1RA/IL-1RN Protein, Human (HEK293)

Cat. No.: HY-P7029A
COA Handling Instructions

IL-1RA/IL-1RN Protein, Human (HEK293) is a member of the IL-1 family that binds to IL-1 receptors.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg $35 In-stock
10 μg $50 In-stock
50 μg $95 In-stock
100 μg $170 In-stock
500 μg $490 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE IL-1RA/IL-1RN Protein, Human (HEK293)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-1RA/IL-1RN Protein, Human (HEK293) is a member of the IL-1 family that binds to IL-1 receptors.

Background

The production of Human Interleukin-1 Receptor Antagonist Protein (IL-1ra) is stimulated by many substances including adherent IgG, other cytokines, and bacterial or viral components. Endogenous IL-1Ra is produced in numerous experimental animal models of disease as well as in human autoimmune and chronic inflammatory diseases. Treatment of human diseases with recombinant human IL-1Ra shows an absence of benefit in sepsis syndrome[1]. IL-1 receptor antagonist (IL-1ra) has provided a tool for blocking IL-1 activity in vivo, leading to a detailed understanding of the role of this cytokine in the inflammatory response[2].

Biological Activity

1.The ED50 is <0.1 μg /mL as measured by D10S cells in the presence of 50.0 pg/mL Human IL-1a.
2.Measured by its ability to inhibit IL-1 alpha -dependent proliferation in CTLL-2 mouse cytotoxic T cells.The ED50 for this effect is 70.48 ng/mL in the presence of 50 pg/mL of rhIL-1 alpha, corresponding to a specific activity is 1.419×104 units/mg.

  • Measured by its ability to inhibit IL-1 alpha -dependent proliferation in CTLL‑2 mouse cytotoxic T cells.The ED50 for this effect is 70.48 ng/mL in the presence of 50 pg/mL of rhIL-1 alpha, corresponding to a specific activity is 1.419×104 units/mg.
Species

Human

Source

HEK293

Tag

Tag Free

Accession

P18510 (R26-E177)

Gene ID
Molecular Construction
N-term
IL-1RA (R26-E177)
Accession # P18510
C-term
Synonyms
rHuIL-1RA; IL-1RN; IRAP
AA Sequence

RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Molecular Weight

Approximately 21.15 & 23.35kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-1RA/IL-1RN Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-1RA/IL-1RN Protein, Human (HEK293)
Cat. No.:
HY-P7029A
Quantity:
MCE Japan Authorized Agent: