IL-1RN Protein, Horse (His)

IL-1RN protein, an anti-inflammatory antagonist, safeguards against immune dysregulation and systemic inflammation triggered by IL1. It acts on proinflammatory cytokines, including IL1B and IL1A, countering the effects of IL1. Particularly responsive to innate stimulatory agents like pathogens, IL-1RN helps mitigate the inflammatory response, ensuring immune homeostasis. IL-1RN Protein, Horse (His) is the recombinant equine-derived IL-1RN protein, expressed by E. coli , with N-6*His labeled tag.

IL-1RN protein is an anti-inflammatory antagonist that acts on the interleukin-1 family of proinflammatory cytokines, including interleukin-1beta/IL1B and interleukin-1alpha/IL1A. It serves as a protective agent against immune dysregulation and uncontrolled systemic inflammation induced by IL1, particularly in response to various innate stimulatory agents like pathogens. IL-1RN helps mitigate the inflammatory response and maintain immune homeostasis by counteracting the effects of IL1.

Measured by its ability to inhibit proliferation of CTLL-2 mouse cytotoxic T cells in the presence of 50 pg/mL of rhIL-1 alpha. The ED₅₀ for this effect is 3.666 μg/mL, corresponding to a specific activity is 272.78 units/mg.

• 
  Measured by its ability to inhibit proliferation of CTLL-2 mouse cytotoxic T cells in the presence of 50 pg/mL of rhIL-1 alpha. The ED₅₀ for this effect is 3.666 μg/mL.

Equine

E. coli

N-6*His

O18999 (H26-Q177)

100034236  [NCBI]

Full Length of Mature Protein

HPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVPIEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTFIRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQEDQ

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.