Copy Link Print Information

IL-1RN Protein, Horse (His)

Customer Review

Based on 1 Customer Validation

IL-1RN protein, an anti-inflammatory antagonist, safeguards against immune dysregulation and systemic inflammation triggered by IL1. It acts on proinflammatory cytokines, including IL1B and IL1A, countering the effects of IL1. Particularly responsive to innate stimulatory agents like pathogens, IL-1RN helps mitigate the inflammatory response, ensuring immune homeostasis. IL-1RN Protein, Horse (His) is the recombinant equine-derived IL-1RN protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Equine
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-1RN Protein, Horse (His)
  • Experimental Validation Results for IL-1RN Protein, Horse (His)
  • IL-1RN Protein, Horse (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-1RN protein, an anti-inflammatory antagonist, safeguards against immune dysregulation and systemic inflammation triggered by IL1. It acts on proinflammatory cytokines, including IL1B and IL1A, countering the effects of IL1. Particularly responsive to innate stimulatory agents like pathogens, IL-1RN helps mitigate the inflammatory response, ensuring immune homeostasis. IL-1RN Protein, Horse (His) is the recombinant equine-derived IL-1RN protein, expressed by E. coli , with N-6*His labeled tag.

Background

IL-1RN protein is an anti-inflammatory antagonist that acts on the interleukin-1 family of proinflammatory cytokines, including interleukin-1beta/IL1B and interleukin-1alpha/IL1A. It serves as a protective agent against immune dysregulation and uncontrolled systemic inflammation induced by IL1, particularly in response to various innate stimulatory agents like pathogens. IL-1RN helps mitigate the inflammatory response and maintain immune homeostasis by counteracting the effects of IL1.

Verified Bioactivity

Measured by its ability to inhibit proliferation of CTLL-2 mouse cytotoxic T cells in the presence of 50 pg/mL of rhIL-1 alpha. The ED50 for this effect is 3.666 μg/mL, corresponding to a specific activity is 272.78 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit proliferation of CTLL-2 mouse cytotoxic T cells in the presence of 50 pg/mL of rhIL-1 alpha. The ED50 for this effect is 3.666 μg/mL.

Technical Parameters

  • Species Equine
  • Source E. coli
  • Tag N-6*His
  • Accession

    O18999 (H26-Q177)

  • Gene ID
    100034236  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • IL-1RN (H26-Q177)
      Accession # O18999
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL1RN; IL-1ra; Interleukin 1 Receptor Antagonist; Intracellular Interleukin-1 Receptor Antagonist (IcIL-1ra); ICIL-1RA; Intracellular Interleukin-1 Receptor Antagonist; IL-1RN; Intracellular IL-1 Receptor Antagonist Type II; IL1RA; Type II Interleukin-1 R

  • AA Sequence

    HPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVPIEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTFIRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQEDQ

  • Predicted Molecular Mass

    17.2 kDa

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit proliferation of CTLL-2 mouse cytotoxic T cells in the presence of 50 pg/mL of rhIL-1 alpha. The ED50 for this effect is 3.666 μg/mL.

  • IL-1RN Protein, Horse (His) Product Image
    1/16
  • Experimental Validation Results for IL-1RN Protein, Horse (His)
  • Experimental Validation Results for IL-1RN Protein, Horse (His)
  • IL-1RN Protein, Horse (His) Product Image