IL-22 Protein, Human (HEK293)
Based on 1 Customer Validation
IL-22 Protein, Human (HEK293) is a HEK293 cell derived cytokine protein and intricate member of the immune response.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-22 Protein, Human (HEK293) is a HEK293 cell derived cytokine protein and intricate member of the immune response.
Background
Interleukin-22 (IL-10-related T cell-derived inducible factor/IL-TIF/IL-22) is a novel cytokine belonging to the IL-10 family. Recombinant humanIL-22 (hIL-22) is found to activate the signal transducers and activators of transcription factors 1 and 3 as well as acute phase reactants in several hepatoma cell lines, suggesting its involvement in the inflammatory response. IL-22 is a member of interleukin-10 family of cytokines, which also includes IL-19, IL-20, and IL-24 in addition to IL-10 and a number of its viral homologs[1].
Verified Bioactivity
Measured by its ability to induce IL-10 secretion in COLO 205 (human colon carcinoma cells). The ED50 for this effect is less than 0.3 ng/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
Q9GZX6 (A34-I179)
-
Molecular Construction
-
N-term
-
IL-22 (A34-I179)
Accession # Q9GZX6 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL22; TIFa; Interleukin 22; IL-10-Related T-Cell-Derived Inducible Factor; IL-TIF; Cytokine Zcyto18; ILTIF; Interleukin-22; IL-22; MGC79382; TIFIL-23; MGC79384; Zcyto18; IL-10-Related T-Cell-Derived-Inducible Factor; IL-D110; Interferon 2B1; IL-21; ZCYTO1
-
AA Sequence
APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
-
Predicted Molecular Mass
17.9 kDa
-
Molecular Weight
Approximately 16-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)