IL-22BP/IL-22RA2 Protein, Human (HEK293, His)

IL-22BP/IL-22RA2 proteins (especially isoform 2) act as IL22 receptors and antagonists, inhibiting IL22 activity by preventing its interaction with functional IL-22R complexes in vitro. This regulatory effect suggests its potential in modulating inflammatory responses. IL-22BP/IL-22RA2 Protein, Human (HEK293, His) is the recombinant human-derived IL-22BP/IL-22RA2 protein, expressed by HEK293 , with C-6*His labeled tag.

IL-22BP, specifically Isoform 2, serves as a receptor for IL22. This isoform not only binds to IL22 but also acts as an antagonist by preventing the interaction between IL22 and the functional IL-22R complex, consequently inhibiting the activity of IL22 in vitro. The regulatory function of Isoform 2 suggests its potential involvement in modulating inflammatory responses. On the other hand, Isoform 1 is implicated in processes related to establishing and maintaining successful pregnancy, indicating a distinct role in reproductive physiology. The dual roles of IL-22BP isoforms highlight their versatility in influencing both inflammatory pathways and reproductive outcomes.

Measured by its ability to inhibit IL-22-induced IL-10 secretion by COLO 205 human colorectal adenocarcinoma cells. The ED₅₀ for this effect is 1.736 ng/mL in the presence of 1 ng/mL of Human IL-22, corresponding to a specific activity is 5.76×10⁵ U/mg.

• 
  Measured by its ability to inhibit IL-22-induced IL-10 secretion by COLO 205 human colorectal adenocarcinoma cells. The ED₅₀ for this effect is 1.736 ng/mL in the presence of 1 ng/mL of Human IL-22, corresponding to a specific activity is 5.76×10⁵ U/mg.

Human

HEK293

C-6*His

Q969J5-2 (T22-P231)

116379  [NCBI]

Partial

TQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP

Approximately 40-50 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB,150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.