1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Interleukin & Receptors Cytokine Receptors
  4. IL-22BP
  5. IL-22BP/IL-22RA2 Protein, Human (HEK293, Fc)

IL-22BP/IL-22RA2 proteins (especially isoform 2) act as IL22 receptors and antagonists, inhibiting IL22 activity by preventing its interaction with functional IL-22R complexes in vitro. This regulatory effect suggests its potential in modulating inflammatory responses. IL-22BP/IL-22RA2 Protein, Human (HEK293, Fc) is the recombinant human-derived IL-22BP/IL-22RA2 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-22BP/IL-22RA2 proteins (especially isoform 2) act as IL22 receptors and antagonists, inhibiting IL22 activity by preventing its interaction with functional IL-22R complexes in vitro. This regulatory effect suggests its potential in modulating inflammatory responses. IL-22BP/IL-22RA2 Protein, Human (HEK293, Fc) is the recombinant human-derived IL-22BP/IL-22RA2 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

IL-22BP, specifically Isoform 2, serves as a receptor for IL22. This isoform not only binds to IL22 but also acts as an antagonist by preventing the interaction between IL22 and the functional IL-22R complex, consequently inhibiting the activity of IL22 in vitro. The regulatory function of Isoform 2 suggests its potential involvement in modulating inflammatory responses. On the other hand, Isoform 1 is implicated in processes related to establishing and maintaining successful pregnancy, indicating a distinct role in reproductive physiology. The dual roles of IL-22BP isoforms highlight their versatility in influencing both inflammatory pathways and reproductive outcomes.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q969J5-1 (T22-P263)

Gene ID
Molecular Construction
N-term
IL-22BP (T22-P263)
Accession # Q969J5-1
hFc
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Interleukin-22 receptor subunit alpha-2; IL-22RA2; CRF2-10; CRF2-S1; IL-22BP; ZcytoR16
AA Sequence

TQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIMFSCSMKSSHQKPSGCWQHISCNFPGCRTLAKYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP

Predicted Molecular Mass
55 kDa
Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

IL-22BP/IL-22RA2 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-22BP/IL-22RA2 Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-22BP/IL-22RA2 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P75854
Quantity:
MCE Japan Authorized Agent: