1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Interleukin & Receptors Cytokine Receptors
  4. IL-22BP
  5. IL-22BP/IL-22RA2 Protein, Human (HEK293, Fc)

IL-22BP/IL-22RA2 proteins (especially isoform 2) act as IL22 receptors and antagonists, inhibiting IL22 activity by preventing its interaction with functional IL-22R complexes in vitro. This regulatory effect suggests its potential in modulating inflammatory responses. IL-22BP/IL-22RA2 Protein, Human (HEK293, Fc) is the recombinant human-derived IL-22BP/IL-22RA2 protein, expressed by HEK293 , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

IL-22BP/IL-22RA2 proteins (especially isoform 2) act as IL22 receptors and antagonists, inhibiting IL22 activity by preventing its interaction with functional IL-22R complexes in vitro. This regulatory effect suggests its potential in modulating inflammatory responses. IL-22BP/IL-22RA2 Protein, Human (HEK293, Fc) is the recombinant human-derived IL-22BP/IL-22RA2 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

IL-22BP, specifically Isoform 2, serves as a receptor for IL22. This isoform not only binds to IL22 but also acts as an antagonist by preventing the interaction between IL22 and the functional IL-22R complex, consequently inhibiting the activity of IL22 in vitro. The regulatory function of Isoform 2 suggests its potential involvement in modulating inflammatory responses. On the other hand, Isoform 1 is implicated in processes related to establishing and maintaining successful pregnancy, indicating a distinct role in reproductive physiology. The dual roles of IL-22BP isoforms highlight their versatility in influencing both inflammatory pathways and reproductive outcomes.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q969J5-1 (T22-P263)

Gene ID
Molecular Construction
N-term
IL-22BP (T22-P263)
Accession # Q969J5-1
hFc
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Interleukin-22 receptor subunit alpha-2; IL-22RA2; CRF2-10; CRF2-S1; IL-22BP; ZcytoR16
AA Sequence

TQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIMFSCSMKSSHQKPSGCWQHISCNFPGCRTLAKYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP

Predicted Molecular Mass
55 kDa
Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
References

IL-22BP/IL-22RA2 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

IL-22BP/IL-22RA2 Protein, Human (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
IL-22BP/IL-22RA2 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P75854
수량:
MCE Japan Authorized Agent: