1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Interleukin & Receptors Cytokine Receptors
  4. IL-22 Receptor
  5. IL-22R alpha 1
  6. IL-22R alpha 1 Protein, Canine (HEK293, Fc)

IL-22R alpha 1 (IL22RA1) Protein is an IL-22 receptor. IL-22R alpha 1 Protein interacts with IL-22 to activate the JAK/STAT cascade thereby inhibits IL-22 mediated promotion of cell proliferation and anti-apoptosis. IL-22R alpha 1 Protein, Canine (HEK293, Fc) is expressed by HEK 293 cells and with a Fc tag at the C-terminus.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

IL-22R alpha 1 (IL22RA1) Protein is an IL-22 receptor. IL-22R alpha 1 Protein interacts with IL-22 to activate the JAK/STAT cascade thereby inhibits IL-22 mediated promotion of cell proliferation and anti-apoptosis. IL-22R alpha 1 Protein, Canine (HEK293, Fc) is expressed by HEK 293 cells and with a Fc tag at the C-terminus[1].

Background

IL-22R alpha 1 (IL22RA1) Protein is a single-pass type I membrane protein. IL-22R alpha 1 expresses in colon, liver, lung, pancreas and kidney. IL-22R alpha 1 is primarily present on epithelial cells and certain monocyte subsets, and very limited IL-22R alpha 1 expression is found on other immune cells[1][2].
The sequence of amino acids in IL-22R alpha 1 from different species is very different (less than 85% similarity among human, rat and Canine).
IL-22R alpha 1 is an essential component of the high-affinity IL-22 receptor enabling IL-22 signaling via JAK/STAT pathways. IL-22R alpha 1 is a component of one of the receptors for IL-20 and IL-24 formed and signaling through STATs activation. IL-22R alpha 1 mediates IL-24 antiangiogenic activity as well as IL24 inhibitory effect on endothelial cell tube formation and differentiation[2][3].

Species

Canine

Source

HEK293

Tag

C-hFc

Accession

A0A8C0M3C4/XP_855113.2 (A15-T226)

Gene ID
Molecular Construction
N-term
IL-22Rα 1 (A15-T226)
Accession # A0A8C0M3C4/XP_855113.2
hFc
C-term
Protein Length

Partial

Synonyms
Interleukin-22 receptor subunit alpha-1; IL-22R-alpha-1; IL-22RA1; CRF2-9; ZcytoR11; IL22R
AA Sequence

AHIAEDTSDLLQYVKFQSSNFENILTWDSGLESAPDVVYSVEYKTYGKKEWLAKEGCQRITRKSCNLTTETGNHTEHYYARVTAVSAGGRSATKMTDRFSSMQQTTIKPPDVTCIPKVRSIQMIVHPTSTPIHAEDGHRLTLEDIFQDLFYRLELQVNHTYQMHLGGKQRDYEFIGLSPDTEFLGTITISVPNFFKESAPYVCRVKTLPDRT

Predicted Molecular Mass
51.2 kDa
분자량

Approximately 56 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

IL-22R alpha 1 Protein, Canine (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
IL-22R alpha 1 Protein, Canine (HEK293, Fc)
Cat. No.:
HY-P77423
수량:
MCE Japan Authorized Agent: