1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Interleukin & Receptors Cytokine Receptors
  4. IL-22 Receptor
  5. IL-22R alpha 1
  6. IL-22R alpha 1 Protein, Rat (HEK293, Fc)

IL-22R alpha 1 (IL22RA1) Protein is an IL-22 receptor. IL-22R alpha 1 Protein interacts with IL-22 to activate the JAK/STAT cascade thereby inhibits IL-22 mediated promotion of cell proliferation and anti-apoptosis. IL-22R alpha 1 Protein, Rat (HEK293, Fc) is expressed by HEK 293 cells, with a Fc tag at the C-terminus.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-22R alpha 1 (IL22RA1) Protein is an IL-22 receptor. IL-22R alpha 1 Protein interacts with IL-22 to activate the JAK/STAT cascade thereby inhibits IL-22 mediated promotion of cell proliferation and anti-apoptosis. IL-22R alpha 1 Protein, Rat (HEK293, Fc) is expressed by HEK 293 cells, with a Fc tag at the C-terminus[1].

Background

IL-22R alpha 1 (IL22RA1) Protein is a single-pass type I membrane protein. IL-22R alpha 1 expresses in colon, liver, lung, pancreas and kidney. IL-22R alpha 1 is primarily present on epithelial cells and certain monocyte subsets, and very limited IL-22R alpha 1 expression is found on other immune cells[1][2].
The sequence of amino acids in IL-22R alpha 1 from different species is very different (less than 85% similarity among human, rat and Canine).
IL-22R alpha 1 is an essential component of the high-affinity IL-22 receptor enabling IL-22 signaling via JAK/STAT pathways. IL-22R alpha 1 is a component of one of the receptors for IL-20 and IL-24 formed and signaling through STATs activation. IL-22R alpha 1 mediates IL-24 antiangiogenic activity as well as IL24 inhibitory effect on endothelial cell tube formation and differentiation[2][3].

Biological Activity

Immobilized Human IL-22, His Tag at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Rat IL-22R alpha 1, hFc Tag with the EC50 of <42.2 ng/mL determined by ELISA.

Species

Rat

Source

HEK293

Tag

C-hFc

Accession

D3ZIM3/NP_001178798.1 (H16-A228)

Gene ID
Molecular Construction
N-term
IL-22Rα 1 (H16-A228)
Accession # D3ZIM3/NP_001178798.1
hFc
C-term
Protein Length

Partial

Synonyms
Interleukin-22 receptor subunit alpha-1; IL-22R-alpha-1; CRF2-9; ZcytoR11; IL22R
AA Sequence

HTTEDTSGLLRHVKFQSSNFENILTWDAGPASAPDTVYSVEYKKYGEKEWLAKAGCQRITQKFCNLTVETRNHTEFYYAKVTAVSSGGPPVTKMTDRFSSLQHTTIRPPDVTCIPKVRSIQMLVHPTLTPVLSEDGHQLTLEEIFHDLFYRLKLHVNHTYQMNLEGKQREYEFLGLTPDTEFLGSITILTPILSKESAPYTCRVKTLPDRTWA

Molecular Weight

Approximately 50.8 kDa.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 100 mL-Arginine, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-22R alpha 1 Protein, Rat (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-22R alpha 1 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P77001
Quantity:
MCE Japan Authorized Agent: