IL-24 Protein, Human (HEK293, His)

Interleukin-24 (IL-24) belongs to the IL10 family of cytokines that selectively induces apoptosis in cancer cells and is recognized during melanoma cell differentiation. IL-24 overexpression increases the expression of GADD family genes and induces cell apoptosis. IL-24 Protein, Human (HEK293, His) is the recombinant human-derived IL-24 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of IL-24 Protein, Human (HEK293, His) is 155 a.a., with molecular weight of ~35 kDa.

Interleukin-24 (IL-24) belongs to the IL10 family of cytokines and was identified as a gene induced during the terminal differentiation of melanoma cells. The protein encoded by this gene exhibits a remarkable ability to selectively induce apoptosis in various cancer cells. Overexpression of IL-24 results in elevated expression of several GADD family genes, which is associated with the induction of apoptosis. In melanoma cells, IL-24 induces the phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38) and heat shock 27kDa protein 1 (HSPB2/HSP27), but this effect is not observed in normal immortal melanocytes. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported, emphasizing the complex regulatory landscape of IL-24. With biased expression in lymph node (RPKM 12.3), spleen (RPKM 9.6), and various other tissues, IL-24 plays a crucial role in orchestrating apoptosis and immune responses.

Measured in a cell proliferation assay using BaF3 mouse pro-B cells transfected with human IL­20 Rα and human IL­20 Rβ and the EC₅₀ is typically 0.05-0.25 ng/mL.

Human

HEK293

C-10*His

NP_001172085.1 (Q53-L207）

11009  [NCBI]

QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL

Approximately 35 kDa

Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.