Copy Link Print Information

IL-24 Protein, Human (HEK293, His)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

Interleukin-24 (IL-24) belongs to the IL10 family of cytokines that selectively induces apoptosis in cancer cells and is recognized during melanoma cell differentiation. IL-24 overexpression increases the expression of GADD family genes and induces cell apoptosis. IL-24 Protein, Human (HEK293, His) is the recombinant human-derived IL-24 protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • IL-24 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Interleukin-24 (IL-24) belongs to the IL10 family of cytokines that selectively induces apoptosis in cancer cells and is recognized during melanoma cell differentiation. IL-24 overexpression increases the expression of GADD family genes and induces cell apoptosis. IL-24 Protein, Human (HEK293, His) is the recombinant human-derived IL-24 protein, expressed by HEK293 , with C-10*His labeled tag.

Background

Interleukin-24 (IL-24) belongs to the IL10 family of cytokines and was identified as a gene induced during the terminal differentiation of melanoma cells. The protein encoded by this gene exhibits a remarkable ability to selectively induce apoptosis in various cancer cells. Overexpression of IL-24 results in elevated expression of several GADD family genes, which is associated with the induction of apoptosis. In melanoma cells, IL-24 induces the phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38) and heat shock 27kDa protein 1 (HSPB2/HSP27), but this effect is not observed in normal immortal melanocytes. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported, emphasizing the complex regulatory landscape of IL-24. With biased expression in lymph node (RPKM 12.3), spleen (RPKM 9.6), and various other tissues, IL-24 plays a crucial role in orchestrating apoptosis and immune responses.

Verified Bioactivity

Measured in a cell proliferation assay using BaF3 mouse pro-B cells transfected with human IL­20 Rα and human IL­20 Rβ and the EC50 is typically 0.05-0.25 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-10*His
  • Accession

    Q13007-2/NP_001172085.1 (Q53-L207)

  • Gene ID
    11009  [NCBI]
  • Molecular Construction
    • N-term
    • IL-24 (Q53-L207）)
      Accession # Q13007-2/NP_001172085.1
    • C-term
  • Protein Length

    Full Length of Isoform-2

  • Synonyms

    IL24; IL-4-Induced Secreted Protein; Prev. ST16; Mob-5; Interleukin-24; MDA7; IL10B; Melanoma Differentiation Association Protein 7; IL-24; Suppression Of Tumorigenicity 16 Protein; C49A; Melanocyte-Associated Mda-7; FISP; MDA-7; Suppression Of Tumorigeni

  • AA Sequence

    QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL

  • Predicted Molecular Mass

    19.5 kDa

  • Molecular Weight

    Approximately 35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% Mannitol, 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • IL-24 Protein, Human (HEK293, His) Product Image
    1/16
  • IL-24 Protein, Human (HEK293, His) Product Image