IL-25/IL-17E Protein, Canine (HEK293, Fc)

Interleukin 25, also known as IL-17E, is a unique cytokine of the IL-17 family. Interleukin 25 exclusively was shown to strongly induce expression of the cytokines associated with type 2 immunity. Interleukin 25 is a “barrier surface” cytokine whose expression depends on extrinsic environmental factors and when up-regulated may lead to inflammatory disorders such as atopic dermatitis, psoriasis or asthma. IL-25/IL-17E Protein, Canine (HEK293, Fc) is the recombinant canine-derived IL-25/IL-17E protein, expressed by HEK293 , with N-hFc labeled tag. The total length of IL-25/IL-17E Protein, Canine (HEK293, Fc) is 153 a.a., with molecular weight of ~46.2 kDa.

Interleukin 25, also known as IL-17E, is a unique cytokine of the IL-17 family. Interleukin 25 exclusively was shown to strongly induce expression of the cytokines associated with type 2 immunity. Interleukin 25 is a “barrier surface” cytokine whose expression depends on extrinsic environmental factors and when up-regulated may lead to inflammatory disorders such as atopic dermatitis, psoriasis or asthma. Interleukin 25 is expressed in activated Th2 T cells and induces a very different type of inflammatory response in vivo. Interleukin 25 enables cytokine activity. Interleukin 25 is located in extracellular region^[1][2][3].

Measured by its ability to induce CXCL1 secretion in HT‑29 human colon adenocarcinoma cells. The ED₅₀ for this effect is 1.361 ng/mL, corresponding to a specific activity is 7.348×10⁵ U/mg.

Canine

HEK293

N-hFc

XP_005623293 (L17-A169)

480252  [NCBI]

LNFRIRKDCTHWPNCCPSKRQDPTHEWLKRDTVLKFPGETTSLTHHPESCKASEDGPLNSRSISPWKYELDRDLNRLPQDLYHARCLCQHCVSLQTGSHMDPLGNSELLYHNQTVFYRRPCPGEQGAPDGYCLEQRLYRVSLACVCVRPRVMA

Approximately 50-55 kDa due to the glycosylation

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.