Copy Link Print Information

IL-33 Protein, Human

4 Cited Publications
Customer Review

Based on 4 publication(s) in Google Scholar

IL-33 Protein, Human, a Th2 cytokine, is a specific ligand for ST2L.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-33 Protein, Human
  • Experimental Validation Results for IL-33 Protein, Human
  • Experimental Validation Results for IL-33 Protein, Human
  • Experimental Validation Results for IL-33 Protein, Human
  • Experimental Validation Results for IL-33 Protein, Human
  • Experimental Validation Results for IL-33 Protein, Human
  • Experimental Validation Results for IL-33 Protein, Human
  • Experimental Validation Results for IL-33 Protein, Human
  • IL-33 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-33 Protein, Human, a Th2 cytokine, is a specific ligand for ST2L.

Background

Human IL-33 is a proinflammatory protein that shares structural and functional characteristics with the IL-1 cytokine family. It binds and signals through the IL-1RL1/ST2 receptor activating NF-kappaB and MAP kinases. IL-33 induces production of Th2 cell related cytokines including IL-4, IL-5 and IL-13, and exerts multiple inflammation related bioactivities. The IL-33-ST2 signaling cascade plays some roles in the pathophysiology of chronic allergic conjunctivitis through the activation of mast cells[1].

Verified Bioactivity

1.The ED50 is <0.5 ng/mL as measured by D10S cells, corresponding to a specific activity of >2.0 × 106 units/mg.
2.Measured by its binding ability in a functional ELISA. Immobilized Human IL-1RL1, Fc Tag at 5 μg/mL (100 μL/well) can bind Biotinylated Human IL-33. The ED50 for this effect is 5-30 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    O95760-1 (S112-T270)

  • Gene ID
    90865  [NCBI]
  • Molecular Construction
    • N-term
    • IL-33 (S112-T270)
      Accession # O95760-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    IL33; DVS27-Related Protein; Prev. C9orf26; Chromosome 9 Open Reading Frame 26 (NF-HEV); NF-HEV; Interleukin-1 Family, Member 11; IL1F11; Alternative Protein IL33; Interleukin-33; IL-1F11; DVS27; NFEHEV; Nuclear Factor From High Endothelial Venules; IL-33

  • AA Sequence

    SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

  • Predicted Molecular Mass

    18.1 kDa

  • Molecular Weight

    Approximately 18-19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Matsuda A, et al. The role of interleukin-33 in chronic allergic conjunctivitis. Invest Ophthalmol Vis Sci. 2009 Oct;50(10):4646-52. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. mmobilized Human IL-1RL1, Fc Tag at 5 μg/mL (100 μL/well) can bind Biotinylated Human IL-33, The ED50 for this effect is 16.45 ng/mL.

  • 1/16

    IL-33 Protein, Human purchased from MedChemExpress. Usage Cited in: Cells. 2025 Jul 1;14(13):1004. [Abstract]

    Customer Validation
     HK2 mRNA levels were measured after 48 h of stimulation with HDM, IL-1β, IL-33 (IL-33 Protein, Human, 20 μg/mL), IL-6, IL-8, LPS, TGF-β, or TNF-α (n = 6 per group). The results showed that IL-33 did not significantly alter HK2 expression.

  • 1/16

    IL-33 Protein, Human purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Oct 31;143(Pt 3):113433. [Abstract]

    Customer Validation
     Representative fluorescence images of Ki67 staining (red) of HUVECs, nuclei were counterstained with DAPI (blue), scale bar = 20 μm. The results showed that ECs subjected to hypoxic conditions exhibited decreased Ki67 staining intensity, and the decreased proliferation was reversed after IL-33 (IL-33 Protein, Human, 20 ng/mL; 4 h) supplementation, indicating an increase in cell proliferation.

  • 1/16

    IL-33 Protein, Human purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Oct 31;143(Pt 3):113433. [Abstract]

    Customer Validation
     Representative images of endothelial function including migration (wound healing and transwell) assays in endothelial cells with different treatment, scale bar = 100 μm. The results showed that following treatment of hypoxic endothelial cells with IL-33 (IL-33 Protein, Human, 20 ng/mL; 4 h), endothelial migration also improved significantly.

  • 1/16

    IL-33 Protein, Human purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Oct 31;143(Pt 3):113433. [Abstract]

    Customer Validation
     Representative images of endothelial function including tube formation (Matrigel) and aortic ring assays in endothelial cells with different treatment, scale bar = 100 μm. The results showed that IL-33 (IL-33 Protein, Human, 20 ng/mL; 4 h) treatment led to a significant enhancement of tube formation and vessel sprouting in mouse aortic rings, surpassing the effects observed under hypoxic conditions alone.

  • 1/16

    IL-33 Protein, Human purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Oct 31;143(Pt 3):113433. [Abstract]

    Customer Validation
     IL-33 (IL-33 Protein, Human, 20 ng/mL; 4 h) treatment upregulated the phosphorylation levels of Akt and eNOS compared with that of the hypoxic group in HUVECs.

  • 1/16

    IL-33 Protein, Human purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Oct 31;143(Pt 3):113433. [Abstract]

    Customer Validation
     Representative fluorescence images of HUVECs stained with NO fluorescent probe (DAF-FM DA) under different conditions, scale bar = 20 μm. The results showed that IL-33 (IL-33 Protein, Human, 20 ng/mL; 4 h) stimulated NO production in ECs under hypoxic conditions, implying that NO plays a role in mediating IL-33-induced angiogenesis.

  • IL-33 Protein, Human Product Image
    1/16
  • Experimental Validation Results for IL-33 Protein, Human
  • Experimental Validation Results for IL-33 Protein, Human
  • Experimental Validation Results for IL-33 Protein, Human
  • Experimental Validation Results for IL-33 Protein, Human
  • Experimental Validation Results for IL-33 Protein, Human
  • Experimental Validation Results for IL-33 Protein, Human
  • Experimental Validation Results for IL-33 Protein, Human
  • Experimental Validation Results for IL-33 Protein, Human
  • IL-33 Protein, Human Product Image

  • IL-33 Protein, Human purchased from MedChemExpress. Usage Cited in: Cells. 2025 Jul 1;14(13):1004. [Abstract]

    HK2 mRNA levels were measured after 48 h of stimulation with HDM, IL-1β, IL-33 (IL-33 Protein, Human, 20 μg/mL), IL-6, IL-8, LPS, TGF-β, or TNF-α (n = 6 per group). The results showed that IL-33 did not significantly alter HK2 expression.

  • IL-33 Protein, Human purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Oct 31;143(Pt 3):113433. [Abstract]

    Representative fluorescence images of Ki67 staining (red) of HUVECs, nuclei were counterstained with DAPI (blue), scale bar = 20 μm. The results showed that ECs subjected to hypoxic conditions exhibited decreased Ki67 staining intensity, and the decreased proliferation was reversed after IL-33 (IL-33 Protein, Human, 20 ng/mL; 4 h) supplementation, indicating an increase in cell proliferation.

  • IL-33 Protein, Human purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Oct 31;143(Pt 3):113433. [Abstract]

    Representative images of endothelial function including migration (wound healing and transwell) assays in endothelial cells with different treatment, scale bar = 100 μm. The results showed that following treatment of hypoxic endothelial cells with IL-33 (IL-33 Protein, Human, 20 ng/mL; 4 h), endothelial migration also improved significantly.

  • IL-33 Protein, Human purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Oct 31;143(Pt 3):113433. [Abstract]

    Representative images of endothelial function including tube formation (Matrigel) and aortic ring assays in endothelial cells with different treatment, scale bar = 100 μm. The results showed that IL-33 (IL-33 Protein, Human, 20 ng/mL; 4 h) treatment led to a significant enhancement of tube formation and vessel sprouting in mouse aortic rings, surpassing the effects observed under hypoxic conditions alone.

  • IL-33 Protein, Human purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Oct 31;143(Pt 3):113433. [Abstract]

    IL-33 (IL-33 Protein, Human, 20 ng/mL; 4 h) treatment upregulated the phosphorylation levels of Akt and eNOS compared with that of the hypoxic group in HUVECs.

  • IL-33 Protein, Human purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Oct 31;143(Pt 3):113433. [Abstract]

    Representative fluorescence images of HUVECs stained with NO fluorescent probe (DAF-FM DA) under different conditions, scale bar = 20 μm. The results showed that IL-33 (IL-33 Protein, Human, 20 ng/mL; 4 h) stimulated NO production in ECs under hypoxic conditions, implying that NO plays a role in mediating IL-33-induced angiogenesis.