1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-33
  5. IL-33 Protein, Human

IL-33 Protein, Human, a Th2 cytokine, is a specific ligand for ST2L.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
IF
RT-PCR
Cell Migration/Invasion Assay
2D/3D Cell Culture and Differentiation
WB
Cell Imaging/Staining

    IL-33 Protein, Human purchased from MCE. Usage Cited in: Cells. 2025 Jul 1;14(13):1004.  [Abstract]

    HK2 mRNA levels were measured after 48 h of stimulation with HDM, IL-1β, IL-33 (IL-33 Protein, Human, 20 μg/mL), IL-6, IL-8, LPS, TGF-β, or TNF-α (n = 6 per group). The results showed that IL-33 did not significantly alter HK2 expression.

    IL-33 Protein, Human purchased from MCE. Usage Cited in: Int Immunopharmacol. 2024 Oct 31;143(Pt 3):113433.  [Abstract]

    Representative fluorescence images of Ki67 staining (red) of HUVECs, nuclei were counterstained with DAPI (blue), scale bar = 20 μm. The results showed that ECs subjected to hypoxic conditions exhibited decreased Ki67 staining intensity, and the decreased proliferation was reversed after IL-33 (IL-33 Protein, Human, 20 ng/mL; 4 h) supplementation, indicating an increase in cell proliferation.

    IL-33 Protein, Human purchased from MCE. Usage Cited in: Int Immunopharmacol. 2024 Oct 31;143(Pt 3):113433.  [Abstract]

    Representative images of endothelial function including migration (wound healing and transwell) assays in endothelial cells with different treatment, scale bar = 100 μm. The results showed that following treatment of hypoxic endothelial cells with IL-33 (IL-33 Protein, Human, 20 ng/mL; 4 h), endothelial migration also improved significantly.

    IL-33 Protein, Human purchased from MCE. Usage Cited in: Int Immunopharmacol. 2024 Oct 31;143(Pt 3):113433.  [Abstract]

    Representative images of endothelial function including tube formation (Matrigel) and aortic ring assays in endothelial cells with different treatment, scale bar = 100 μm. The results showed that IL-33 (IL-33 Protein, Human, 20 ng/mL; 4 h) treatment led to a significant enhancement of tube formation and vessel sprouting in mouse aortic rings, surpassing the effects observed under hypoxic conditions alone.

    IL-33 Protein, Human purchased from MCE. Usage Cited in: Int Immunopharmacol. 2024 Oct 31;143(Pt 3):113433.  [Abstract]

    IL-33 (IL-33 Protein, Human, 20 ng/mL; 4 h) treatment upregulated the phosphorylation levels of Akt and eNOS compared with that of the hypoxic group in HUVECs.

    IL-33 Protein, Human purchased from MCE. Usage Cited in: Int Immunopharmacol. 2024 Oct 31;143(Pt 3):113433.  [Abstract]

    Representative fluorescence images of HUVECs stained with NO fluorescent probe (DAF-FM DA) under different conditions, scale bar = 20 μm. The results showed that IL-33 (IL-33 Protein, Human, 20 ng/mL; 4 h) stimulated NO production in ECs under hypoxic conditions, implying that NO plays a role in mediating IL-33-induced angiogenesis.
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    IL-33 Protein, Human, a Th2 cytokine, is a specific ligand for ST2L.

    Background

    Human IL-33 is a proinflammatory protein that shares structural and functional characteristics with the IL-1 cytokine family. It binds and signals through the IL-1RL1/ST2 receptor activating NF-kappaB and MAP kinases. IL-33 induces production of Th2 cell related cytokines including IL-4, IL-5 and IL-13, and exerts multiple inflammation related bioactivities. The IL-33-ST2 signaling cascade plays some roles in the pathophysiology of chronic allergic conjunctivitis through the activation of mast cells[1].

    Biological Activity

    1.The ED50 is <0.5 ng/mL as measured by D10S cells, corresponding to a specific activity of >2.0 × 106 units/mg.
    2.Measured by its binding ability in a functional ELISA, mmobilized Human IL-1RL1, Fc Tag at 5 μg/mL (100 μL/well) can bind Human IL-33. The ED50 for this effect is 16.45 ng/mL.

    • Measured by its binding ability in a functional ELISA. mmobilized Human IL-1RL1, Fc Tag at 5 μg/mL (100 μL/well) can bind Human IL-33, The ED50 for this effect is 16.45 ng/mL.
    Species

    Human

    Source

    E. coli

    Tag

    Tag Free

    Accession

    O95760-1 (S112-T270)

    Gene ID
    Molecular Construction
    N-term
    IL-33 (S112-T270)
    Accession # O95760-1
    C-term
    Protein Length

    Partial

    Synonyms
    rHuIL-33; IL-1F11; NF-HEV; DVS 27
    AA Sequence

    SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

    Predicted Molecular Mass
    18.1 kDa
    Molecular Weight

    Approximately 18-18 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
    2.Lyophilized from a 0.22 μm filtered solution of PBS.
    3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
    Please refer to the lot-specific COA for specific buffer information.
    Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References

    IL-33 Protein, Human Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    IL-33 Protein, Human

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    IL-33 Protein, Human
    Cat. No.:
    HY-P7041
    Quantity:
    MCE Japan Authorized Agent: