1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-33
  5. IL-33 Protein, Human

IL-33 Protein, Human

Cat. No.: HY-P7041
COA Handling Instructions

IL-33 Protein, Human, a Th2 cytokine, is a specific ligand for ST2L.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $45 In-stock
10 μg $125 In-stock
50 μg $350 In-stock
100 μg $595 In-stock
500 μg $1500 In-stock
1 mg $2400 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE IL-33 Protein, Human

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-33 Protein, Human, a Th2 cytokine, is a specific ligand for ST2L.

Background

Human IL-33 is a proinflammatory protein that shares structural and functional characteristics with the IL-1 cytokine family. It binds and signals through the IL-1RL1/ST2 receptor activating NF-kappaB and MAP kinases. IL-33 induces production of Th2 cell related cytokines including IL-4, IL-5 and IL-13, and exerts multiple inflammation related bioactivities. The IL-33-ST2 signaling cascade plays some roles in the pathophysiology of chronic allergic conjunctivitis through the activation of mast cells[1].

Biological Activity

1.The ED50 is <0.5 ng/mL as measured by D10S cells, corresponding to a specific activity of >2.0 × 106 units/mg.
2.Measured by its binding ability in a functional ELISA, mmobilized Human IL-1RL1, Fc Tag at 5 μg/mL (100 μL/well) can bind Human IL-33. The ED50 for this effect is 16.45 ng/mL.

  • Measured by its binding ability in a functional ELISA. mmobilized Human IL-1RL1, Fc Tag at 5 μg/mL (100 μL/well) can bind Human IL-33,The ED50 for this effect is 16.45 ng/mL.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

O95760 (S112-T270)

Gene ID
Molecular Construction
N-term
IL-33 (S112-T270)
Accession # O95760
C-term
Synonyms
rHuIL-33; IL-1F11; NF-HEV; DVS 27
AA Sequence

SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

Molecular Weight

Approximately 18.0 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS or 20 mM PB, 150 mM NaCl, pH 7.4 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-33 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-33 Protein, Human
Cat. No.:
HY-P7041
Quantity:
MCE Japan Authorized Agent: