IL-5R alpha Protein, Mouse (HEK293, His)
IL-5R alpha protein is a cytokine receptor that is expressed on eosinophils, basophils and B cells and is involved in inflammation and immune regulation. IL-5R alpha Protein, Mouse (HEK293, His) is expressed by HEK293 cells and is a transmembrane protein with a C-6*His tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IL-5R alpha protein is a cytokine receptor that is expressed on eosinophils, basophils and B cells and is involved in inflammation and immune regulation. IL-5R alpha Protein, Mouse (HEK293, His) is expressed by HEK293 cells and is a transmembrane protein with a C-6*His tag[1][3].
Background
IL-5R alpha is a type I cytokine receptor consisting of two distinct polypeptide chains, alpha and beta. alpha chain is a membrane-penetrating glycoprotein that specifically binds IL-5 and beta chain converts low affinity IL-5R to high affinity IL-5R, forming a heterodimeric receptor complex[1].
IL-5R alpha can induce the activation of multiple intracellular signalling pathways, including JAK/STAT, RAF/MAP, Ras-Raf-ERK and phosphatidylinositol 3-kinase when its binds with IL-5[2].
IL-5R alpha is expressed on eosinophils, basophils and B cells and affects cell survival, apoptosis, differentiation and chemotaxis[3].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
P21183 (D18-H339)
-
Molecular Construction
-
N-term
-
IL-5Rα (D18-H339)
Accession # P21183 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
IL5RA; IL-5R Subunit Alpha; Prev. IL5R; Interleukin 5 Receptor Alpha Transcript Variant 7; CDw125; Interleukin-5 Receptor Alpha Chain; Interleukin-5 Receptor Subunit Alpha; Interleukin 5 Receptor Type 3; CD125; IL-5R-Alpha; Interleukin 5 Receptor, Alpha;
-
AA Sequence
DLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWGEWSQPIYVGKERKSLVEWH
-
Predicted Molecular Mass
37.6 kDa
-
Molecular Weight
Approximately 48 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
[1]. S Takaki, et al. A critical cytoplasmic domain of the interleukin-5 (IL-5) receptor alpha chain and its function in IL-5-mediated growth signal transduction. Mol Cell Biol. 1994 Nov;14(11):7404-17. [Content Brief]
[2]. R P de Groot, et al. Regulation of proliferation, differentiation and survival by the IL-3/IL-5/GM-CSF receptor family. Cell Signal. 1998 Oct;10(9):619-32. [Content Brief]
[3]. S C Barry, et al. Analysis of interleukin 5 receptors on murine eosinophils: a comparison with receptors on B13 cells. Cytokine. 1991 Jul;3(4):339-48. [Content Brief]
[4]. R Sehmi, et al. Allergen-induced increases in IL-5 receptor alpha-subunit expression on bone marrow-derived CD34+ cells from asthmatic subjects. A novel marker of progenitor cell commitment towards eosinophilic differentiation. J Clin Invest. 1997 Nov 15;100(10):2466-79. [Content Brief]
[5]. H Tanaka, et al. Allergen-induced airway inflammation and bronchial responsiveness in interleukin-5 receptor alpha chain-deficient mice. Clin Exp Allergy. 2000 Jun;30(6):874-85 [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
