1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-5 Receptor
  5. IL-5 Receptor α
  6. IL-5R alpha Protein, Mouse (HEK293, His)

IL-5R alpha Protein, Mouse (HEK293, His)

Cat. No.: HY-P72540
Handling Instructions

IL-5R alpha protein is a cytokine receptor that is expressed on eosinophils, basophils and B cells and is involved in inflammation and immune regulation. IL-5R alpha Protein, Mouse (HEK293, His) is expressed by HEK293 cells and is a transmembrane protein (L340-C361) with a C-6*His tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-5R alpha protein is a cytokine receptor that is expressed on eosinophils, basophils and B cells and is involved in inflammation and immune regulation. IL-5R alpha Protein, Mouse (HEK293, His) is expressed by HEK293 cells and is a transmembrane protein (L340-C361) with a C-6*His tag[1][3].

Background

IL-5R alpha is a type I cytokine receptor consisting of two distinct polypeptide chains, alpha and beta. alpha chain is a membrane-penetrating glycoprotein that specifically binds IL-5 and beta chain converts low affinity IL-5R to high affinity IL-5R, forming a heterodimeric receptor complex[1].
IL-5R alpha can induce the activation of multiple intracellular signalling pathways, including JAK/STAT, RAF/MAP, Ras-Raf-ERK and phosphatidylinositol 3-kinase when its binds with IL-5[2].
IL-5R alpha is expressed on eosinophils, basophils and B cells and affects cell survival, apoptosis, differentiation and chemotaxis[3].

In Vitro

IL-5R alpha expression is increased in myeloma CD34+ cells and facilitates eosinophil production and may further promote the subsequent development of blood and tissue eosinophilia, a hallmark of allergic inflammation[4].

In Vivo

IL-5R alpha plays a key role in the development of airway eosinophilia and bronchial hyperresponsiveness (BHR) in mice, but not in antigen-induced elevation of serum IgE by performing allergen induction in IL-5Rα KO-deficient mice[5].

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P21183 (D18-H339)

Gene ID

16192  [NCBI]

Molecular Construction
N-term
IL-5Rα (D18-H339)
Accession # P21183
6*His
C-term
Synonyms
Interleukin-5 receptor subunit alpha; IL-5R-alpha; IL-5RA; CDw125; CD125; IL5R
AA Sequence

DLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWGEWSQPIYVGKERKSLVEWH

Molecular Weight

Approximately 48 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

IL-5R alpha Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-5R alpha Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72540
Quantity:
MCE Japan Authorized Agent: