1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors Neurotrophic Factors
  4. IL-6
  5. IL-6 Protein, Human

IL-6 Protein, Human

Cat. No.: HY-P7044
COA Handling Instructions

IL-6 Protein, Human is a potent inducer of the synthesis of acute phase proteins in adult human hepatocytes.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $40 In-stock
5 μg $65 In-stock
10 μg $110 In-stock
50 μg $320 In-stock
100 μg $440 In-stock
500 μg $950 In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Customer Validation
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-6 Protein, Human is a potent inducer of the synthesis of acute phase proteins in adult human hepatocytes.

Background

Interleukin-6 (IL-6) is a 26-kD protein released by fibroblasts, T lymphocytes, endothelial cells, monocytes, and keratinocytes during inflammatory responses. IL-6 has pluripotent activities, including the stimulation of the monocytic lineage, the induction of megakaryopoiesis and the hepatic acute phase response, as well as the modulation of T- and B-cell responses. IL-6 is also capable of mediating direct and indirect tumor cell destruction and that it is potentially important for the immunotherapy of cancer[1. Recombinant human interleukin-6 (IL-6/BSF-2/HSF) regulates the synthesis of acute phase proteins in human hepatocytes[2].

Biological Activity

1.The ED50 is <1.5 ng/mL as measured by TF-1 cells, corresponding to a specific activity of > 6× 105 units/mg.
2.ED50 <0.1 ng/mL, measured by the dose dependent stimulation of the proliferation of IL-6 dependent murine 7TD1 cells, corresponding to a specilic activity of > 1 x 107 units/mg.

  • Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is 0.2019 ng/mL,corresponding to a specific activity is 4.95×106 units/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P05231 (V30-M212)

Gene ID
Synonyms
rHuIL-6; BSF-2; CDF; Hybridoma growth factor; IFN-beta-2
AA Sequence

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Molecular Weight

Approximately 18-22 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against 20 mM HAc-NaAc, pH 5.0, 150 mM NaAc buffer or PBS, pH 7.4 .

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-6 Protein, Human
Cat. No.:
HY-P7044
Quantity:
MCE Japan Authorized Agent: