IL-6 Protein, Human

IL-6 Protein, Human is a potent inducer of the synthesis of acute phase proteins in adult human hepatocytes.

Interleukin-6 (IL-6) is a 26-kD protein released by fibroblasts, T lymphocytes, endothelial cells, monocytes, and keratinocytes during inflammatory responses. IL-6 has pluripotent activities, including the stimulation of the monocytic lineage, the induction of megakaryopoiesis and the hepatic acute phase response, as well as the modulation of T- and B-cell responses. IL-6 is also capable of mediating direct and indirect tumor cell destruction and that it is potentially important for the immunotherapy of cancer^[1. Recombinant human interleukin-6 (IL-6/BSF-2/HSF) regulates the synthesis of acute phase proteins in human hepatocytes[2].

1.The ED₅₀ is <1.5 ng/mL as measured by TF-1 cells, corresponding to a specific activity of > 6× 10⁵ units/mg.
2.ED₅₀ <0.1 ng/mL, measured by the dose dependent stimulation of the proliferation of IL-6 dependent murine 7TD1 cells, corresponding to a specilic activity of > 1 x 10⁷ units/mg.

• 
  Measured in a cell proliferation assay using TF-1 cells. The ED₅₀ for this effect is 0.2019 ng/mL，corresponding to a specific activity is 4.95×10⁶ units/mg.

Human

E. coli

Tag Free

P05231 (V30-M212)

3569  [NCBI]

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Approximately 18-22 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against 20 mM HAc-NaAc, pH 5.0, 150 mM NaAc buffer or PBS, pH 7.4 .

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Nieken J, et al. Recombinant human interleukin-6 induces a rapid and reversible anemia in cancer patients. Blood. 1995 Aug 1;86(3):900-5.  [Content Brief]

  [2]. Castell JV, et al. Recombinant human interleukin-6 (IL-6/BSF-2/HSF) regulates the synthesis of acute phase proteins in human hepatocytes. FEBS Lett. 1988 May 23;232(2):347-50.  [Content Brief]