Copy Link Print Information

IL-6 Protein, Human

60 Cited Publications
Customer Review

Based on 60 publication(s) in Google Scholar

IL-6 protein is a multifunctional cytokine that plays multiple biological functions in immunity, tissue regeneration, and metabolism. After binding to IL6R, the resulting complex binds to the signaling subunit IL6ST/gp130, triggering the intracellular IL6 signaling pathway. IL-6 Protein, Human (N-His) is the recombinant human-derived IL-6 protein, expressed by E. coli.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-6 Protein, Human
  • Experimental Validation Results for IL-6 Protein, Human
  • Experimental Validation Results for IL-6 Protein, Human
  • Experimental Validation Results for IL-6 Protein, Human
  • Experimental Validation Results for IL-6 Protein, Human
  • Experimental Validation Results for IL-6 Protein, Human
  • Experimental Validation Results for IL-6 Protein, Human
  • IL-6 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-6 protein is a multifunctional cytokine that plays multiple biological functions in immunity, tissue regeneration, and metabolism. After binding to IL6R, the resulting complex binds to the signaling subunit IL6ST/gp130, triggering the intracellular IL6 signaling pathway. IL-6 Protein, Human (N-His) is the recombinant human-derived IL-6 protein, expressed by E. coli.

Background

Interleukin-6 (IL-6) is a 26-kD protein released by fibroblasts, T lymphocytes, endothelial cells, monocytes, and keratinocytes during inflammatory responses. IL-6 has pluripotent activities, including the stimulation of the monocytic lineage, the induction of megakaryopoiesis and the hepatic acute phase response, as well as the modulation of T- and B-cell responses. IL-6 is also capable of mediating direct and indirect tumor cell destruction and that it is potentially important for the immunotherapy of cancer[1. Recombinant human interleukin-6 (IL-6/BSF-2/HSF) regulates the synthesis of acute phase proteins in human hepatocytes[2].

In Vitro

IL-6 protein (Human, 10 ng/mL, 24 h) activates STAT3 signaling pathway, and promotes the expression of the PIM1 gene in cancer cells T47D and MCF-7, enhances cell invasion, and induces epithelial-mesenchymal transition (EMT) and stemness of T47D and MCF-7[3].

In Vivo

IL-6 protein (Human, 5-80 μg/kg/day, sc, twice daily for 14 days) promotes the platelet production and the maturation of megakaryocytes in rhesus monkey. IL-6 protein also causes side effects such as weight loss, anemia, neutrophilia, and monocytosis in rhesus monkey[4].

Verified Bioactivity

1.The ED50 is <1.5 ng/mL as measured by TF-1 cells, corresponding to a specific activity of > 6× 105 units/mg.
2.ED50 <0.1 ng/mL, measured by the dose dependent stimulation of the proliferation of IL-6 dependent murine 7TD1 cells, corresponding to a specilic activity of > 1 x 107 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P05231 (V30-M212)

  • Gene ID
    3569  [NCBI]
  • Molecular Construction
    • N-term
    • IL-6 (V30-M212)
      Accession # P05231
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL6; Hybridoma Growth Factor; Prev. IFNB2; IFN-Beta-2; IL-6; BSF-2; Interleukin-6; CDF; BSF2; Interleukin 6 (Interferon, Beta 2); HGF; B-Cell Differentiation Factor; HSF; Truncated Interleukin 6; B-Cell Stimulatory Factor 2; Interferon, Beta 2; CTL Differ

  • AA Sequence

    VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

  • Predicted Molecular Mass

    20.9 kDa

  • Molecular Weight

    Approximately 20-21 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized after extensive dialysis against 20 mM HAc-NaAc, pH 5.0, 150 mM NaAc buffer.
2.Lyophilized after extensive dialysis against PBS, pH 7.4.
3.Lyophilized after extensive dialysis against PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Nieken J, et al. Recombinant human interleukin-6 induces a rapid and reversible anemia in cancer patients. Blood. 1995 Aug 1;86(3):900-5. [Content Brief]

[2]. Castell JV, et al. Recombinant human interleukin-6 (IL-6/BSF-2/HSF) regulates the synthesis of acute phase proteins in human hepatocytes. FEBS Lett. 1988 May 23;232(2):347-50. [Content Brief]

[3]. Gao X, et al., PIM1 is responsible for IL-6-induced breast cancer cell EMT and stemness via c-myc activation. Breast Cancer. 2019 Sep;26(5):663-671 [Content Brief]

[4]. Asano S, et al. In vivo effects of recombinant human interleukin-6 in primates: stimulated production of platelets[J]. Blood, 1990, 75(8): 1602-1605.

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     The ED50 is <1.5 ng/mL as measured by TF-1 cells, corresponding to a specific activity of > 6× 105 units/mg.

  • 1/16

    IL-6 Protein, Human purchased from MedChemExpress. Usage Cited in: J Exp Clin Cancer Res. 2025 Oct 17;44(1):291. [Abstract]

    Customer Validation
     WB revealed that IL-6 (50 ng/mL, 24 h) treatment markedly enhanced PI3K and Akt phosphorylation compared with both the blank and solvent control groups.

  • 1/16

    IL-6 Protein, Human purchased from MedChemExpress. Usage Cited in: Cell. 2024 Apr 25;187(9):2288-2304.e27. [Abstract]

    Customer Validation
     Protein levels of the indicated molecules and ATF4 mRNA levels in CD8+ T cells treated with PBS or IL-6 (20 μg/mL).

  • 1/16

    IL-6 Protein, Human purchased from MedChemExpress. Usage Cited in: Int J Biol Sci. 2024 Aug 6;20(11):4222-4237. [Abstract]

    Customer Validation
     IL-6 (50 ng/mL, 24 h) and FAC (12 mg/L, 24 h) increased the Fe2+ content in HAECs by confocal fluorescence imaging detected.

  • 1/16

    IL-6 Protein, Human purchased from MedChemExpress. Usage Cited in: Int J Biol Sci. 2024 Aug 6;20(11):4222-4237. [Abstract]

    Customer Validation
     Flow cytometry detected ROS and apoptosis levels, IL-6 (50 ng/mL, 24 h) clearly sensitized HAECs to FAC-induced damage.

  • 1/16

    IL-6 Protein, Human purchased from MedChemExpress. Usage Cited in: Breast Cancer. 2019 Sep;26(5):663-671. [Abstract]

    Customer Validation
     The mRNA and protein levels of PIM1 in T47D cells treated with IL-6 in gradient concentration are examined by qRT-PCR and western blot, respectively.

  • IL-6 Protein, Human Product Image
    1/16
  • Experimental Validation Results for IL-6 Protein, Human
  • Experimental Validation Results for IL-6 Protein, Human
  • Experimental Validation Results for IL-6 Protein, Human
  • Experimental Validation Results for IL-6 Protein, Human
  • Experimental Validation Results for IL-6 Protein, Human
  • Experimental Validation Results for IL-6 Protein, Human
  • Experimental Validation Results for IL-6 Protein, Human
  • IL-6 Protein, Human Product Image