1. Recombinant Proteins
  2. IL-6 Protein, Human

IL-6 Protein, Human

Cat. No.: HY-P7044
Handling Instructions

IL-6 Protein, Human is a potent inducer of the synthesis of acute phase proteins in adult human hepatocytes.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $490 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

    IL-6 Protein, Human purchased from MCE. Usage Cited in: Breast Cancer. 2019 Sep;26(5):663-671.

    The mRNA and protein levels of PIM1 in T47D cells treated with IL-6 in gradient concentration are examined by qRT-PCR and western blot, respectively.
    • Technical Parameters

    • Properties

    • Documentation

    Synonyms
    rHuIL-6; BSF-2; CDF; Hybridoma growth factor; IFN-beta-2
    Species

    Others

    Source

    E. coli

    Accession

    P05231 (P29-M212)

    Gene ID

    3569

    Molecular Weight

    Approximately 21,000 Da

    AA Sequence

    PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

    Biological Activity
    The ED50 is <0.1 ng/mL as measured by murine 7TD1 cells, corresponding to a specific activity of 5 × 107 units/mg.
    Appearance

    Lyophilized powder.

    Formulation

    Lyophilized after extensive dialysis against 20 mM HAc-NaAc, pH 5.0, 150 mM NaAc buffer.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

    Storage & Stability

    Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Background

    Interleukin-6 (IL-6) is a 26-kD protein released by fibroblasts, T lymphocytes, endothelial cells, monocytes, and keratinocytes during inflammatory responses. IL-6 has pluripotent activities, including the stimulation of the monocytic lineage, the induction of megakaryopoiesis and the hepatic acute phase response, as well as the modulation of T- and B-cell responses. IL-6 is also capable of mediating direct and indirect tumor cell destruction and that it is potentially important for the immunotherapy of cancer[1. Recombinant human interleukin-6 (IL-6/BSF-2/HSF) regulates the synthesis of acute phase proteins in human hepatocytes[2].

    Documentation
    References
    • Molarity Calculator

    • Dilution Calculator

    The molarity calculator equation

    Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

    Mass   Concentration   Volume   Molecular Weight *
    = × ×

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    Product Name

     

    Salutation

    Applicant Name *

     

    Email address *

    Phone number *

     

    Organization name *

    Department *

     

    Requested quantity *

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    IL-6 Protein, Human
    Cat. No.:
    HY-P7044
    Quantity:
    MCE Japan Authorized Agent: