1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors Neurotrophic Factors
  4. IL-1R IL-6 CDNF/MANF family
  5. IL-6 Protein, Rhesus macaque

IL-6 Protein, Rhesus macaque

Cat. No.: HY-P7222
Handling Instructions

IL-6 Protein, Rhesus macaque is a inflammatory related and immunoregulatory cytokine contributing to host defense against infections and tissue injuries.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $590 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Technical Parameters

  • Properties

  • Documentation

Species

Rhesus Macaque

Source

E. coli

Accession

P51494 (A28-M212)

Gene ID

705819

Synonyms
rRhIL-6; IL6
AA Sequence

MAPVLPGEDSKNVAAPHSQPLTSSERIDKHIRYILDGISALRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSNLRALRQM

Molecular Weight

Approximately 21.1 kDa

Biological Activity
The ED50 is <0.1 ng/mL as measured by IL-6-dependent murine 7TD1 cells, corresponding to a specific activity of >1.0 × 107 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

The IL-6 receptor–signaling system is made up of two receptor chains and downstream signaling molecules. The IL-6 receptor (IL-6R) constitutes the IL-6-binding chain, which occurs in two forms, 80 kDa transmembrane and 50-55 kDa-soluble IL-6R (sIL-6R), whereas 130 kDa gp130 constitutes the signal-transducing chain. Both of these proteins belong to the cytokine receptor family with a Trp-Ser-X-Trp-Ser motif[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-6 Protein, Rhesus macaque
Cat. No.:
HY-P7222
Quantity:
MCE Japan Authorized Agent: