IL-7 Protein, Mouse (CHO)

IL-7 Protein, Mouse (CHO) is constitutively produced by stromal cells from the bone marrow and thymus, plays a crucial role in B cell lymphopoiesis and in T cell homeostasis.

Interleukin-7 (IL-7) is a nonredundant cytokine produced by nonlymphoid cells that is essential for T-cell development in humans and mice and B-cell development in mice. IL-7 contributes to the maintenance of the size and subset composition of the peripheral T-cell pool by providing growth and survival signals through the IL-7 receptor. The IL-7 receptor has a private α-chain and shares the common γ-chain (γ_c) with other common cytokine receptor users, such as IL-2, IL-4, IL-15, and IL-21. IL-7 together with these cytokines regulates the expansion and contraction of adaptive immune responses and potentially the memory response to a given antigen. IL-7 modulates memory CD8⁺ T cells in response to a virus infection and, given in conjunction with adoptive transfer of T cells after herpes simplex virus type 1 infection, improves virus clearance^[1].

The ED₅₀ is <0.4 ng/mL as measured by 2E8 cells.

Mouse

CHO

C-His

P10168 (E26-I154)

16196  [NCBI]

ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSIHHHHHH

8-28 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Moniuszko M, et al. Recombinant interleukin-7 induces proliferation of naive macaque CD4⁺ and CD8⁺ T cells in vivo. J Virol. 2004 Sep;78(18):9740-9.  [Content Brief]