IL-8/CXCL8 Protein, Porcine

IL-8/CXCL8 protein, a vital chemotactic factor, orchestrates inflammatory responses by attracting neutrophils, basophils, and T-cells to clear pathogens. It activates neutrophils and binds to CXCR1/CXCR2 receptors, initiating downstream signaling pathways. IL-8/CXCL8 homodimerizes, disrupted by tick evasin-3, and interacts with TNFAIP6, potentially regulating chemokine activity in the inflammatory microenvironment. IL-8/CXCL8 Protein, Porcine is the recombinant Porcine-derived IL-8/CXCL8 protein, expressed by E. coli , with tag free.

IL-8/CXCL8 protein serves as a pivotal chemotactic factor, playing a central role in mediating inflammatory responses by attracting neutrophils, basophils, and T-cells to effectively clear pathogens and protect the host from infections. It also contributes significantly to neutrophil activation. Released in response to inflammatory stimuli, IL-8/CXCL8 exerts its effects by binding to G-protein-coupled receptors CXCR1 and CXCR2, primarily found in neutrophils, monocytes, and endothelial cells. The G-protein heterotrimer (alpha, beta, gamma subunits) constitutively binds to CXCR1/CXCR2 receptors, and activation by IL-8 leads to the release of beta and gamma subunits from Galpha (GNAI2 in neutrophils) and subsequent activation of downstream signaling pathways, including PI3K and MAPK pathways. IL-8/CXCL8 forms homodimers, and this dimerization is disrupted by tick evasin-3. Furthermore, IL-8/CXCL8 interacts with TNFAIP6 via its Link domain, and this interaction interferes with chemokine binding to glycosaminoglycans, suggesting a regulatory role in modulating chemokine activity within the inflammatory microenvironment.

• 
  Measured by its ability to chemoattract BaF3 mouse pro‑B cells transfected with human CXCR2. The ED₅₀ for this effect is 2.303 ng/mL, corresponding to a specific activity is 4.342×10⁵ U/mg.

Porcine

E. coli

Tag Free

CAA43461 (A26-Q104)

396880  [NCBI]

Partial

ARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKEVCLDPKEKWVQKKVVQIFLKRTEKQQQQQ

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.