IL-9 Protein, Mouse (CHO, His)

Customer Review

Based on 1 Customer Validation

IL-9 Protein, Mouse (CHO), derived from CHO cell, is a member of the TH2 cytokine family.IL-9 Protein, Mouse (CHO, His) has recently been implicated as an essential factor in determining mucosal immunity and susceptibility to atopic asthma.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IL-9 Protein, Mouse (CHO), derived from CHO cell, is a member of the TH2 cytokine family.IL-9 Protein, Mouse (CHO, His) has recently been implicated as an essential factor in determining mucosal immunity and susceptibility to atopic asthma.

Background

Interleukin 9 (IL-9) is cytokine produced by a subgroup of helper T cells, known as Th2 cells. IL-9 signals through its receptor IL-9R to induce cell proliferation and survival. Genetically, IL-9 has been identified as a gene associated with asthma.Human interleukin-9 (IL-9) was originally identified and cloned based on its stimulatory effect on proliferation of human myeloid cell line, M07e. IL-9 synergized with Steel factor, the ligand for the c-kit product, to stimulate M07e cell proliferation[1]

Verified Bioactivity

Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 3.339 ng/mL, corresponding to a specific activity is 3.0×105 units/mg.

Technical Parameters

  • Species Mouse
  • Source CHO
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-9 (Q19-P144)
      Accession # P15247
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL9; Homolog Of Mouse T Cell And Mast Cell Growth Factor 40; Interleukin 9; P40 T-Cell And Mast Cell Growth Factor; IL-9; Interleukin-9; T-Cell Growth Factor P40; P40 Cytokine; HP40; Cytokine P40; P40

  • AA Sequence

    QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP

  • Predicted Molecular Mass

    15.2 kDa

  • Molecular Weight

    Approximately 28-42 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00