IL1RAPL1 Protein, Mouse (HEK293, Fc)

IL1RAPL1 protein inhibits N-type calcium channels, regulates secretion, and activates JNK signaling. It promotes neurite growth and bidirectionally induces presynaptic and postsynaptic differentiation by binding to PTPRD during dendritic spine formation. IL1RAPL1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL1RAPL1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of IL1RAPL1 Protein, Mouse (HEK293, Fc) is 333 a.a., with molecular weight of ~85-95 kDa.

The IL1RAPL1 protein appears to exert regulatory control over secretion and presynaptic differentiation by inhibiting the activity of N-type voltage-gated calcium channels. Additionally, it may activate the MAP kinase JNK, suggesting a potential role in intracellular signaling pathways. Furthermore, IL1RAPL1 is implicated in neurite outgrowth, indicating its involvement in the extension of neuronal processes. Notably, during dendritic spine formation, IL1RAPL1 can bidirectionally induce both pre- and post-synaptic differentiation of neurons through trans-synaptic binding to PTPRD. This multifaceted functionality underscores IL1RAPL1's significance in modulating various aspects of neuronal development and synaptic differentiation, with potential implications for neural circuit formation and function. Further investigation into the specific mechanisms and downstream effects of IL1RAPL1 in these processes could provide valuable insights into its role in neurodevelopment.

Measured by its binding ability in a functional ELISA. When Recombinant Human PTPRD is immobilized at 1 µg/mL (100 µL/well) can bind Recombinant Mouse IL1RAPL1. The ED₅₀ for this effect is 20.36 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Human PTPRD is immobilized at 1 µg/mL (100 µL/well) can bind Recombinant Mouse IL1RAPL1. The ED₅₀ for this effect is 20.36 ng/mL.

Mouse

HEK293

C-hFc

P59823 (R25-T357)

331461  [NCBI]

RGSADGCTDWSVDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKAWRPSIVFKRDTLLIKEVKEDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMESKLTVQETQLGGSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYT

Approximately 85-95 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.