Copy Link Print Information

IL1RAPL1 Protein, Mouse (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

IL1RAPL1 protein inhibits N-type calcium channels, regulates secretion, and activates JNK signaling. It promotes neurite growth and bidirectionally induces presynaptic and postsynaptic differentiation by binding to PTPRD during dendritic spine formation. IL1RAPL1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL1RAPL1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL1RAPL1 Protein, Mouse (HEK293, Fc)
  • Experimental Validation Results for IL1RAPL1 Protein, Mouse (HEK293, Fc)
  • IL1RAPL1 Protein, Mouse (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL1RAPL1 protein inhibits N-type calcium channels, regulates secretion, and activates JNK signaling. It promotes neurite growth and bidirectionally induces presynaptic and postsynaptic differentiation by binding to PTPRD during dendritic spine formation. IL1RAPL1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL1RAPL1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The IL1RAPL1 protein appears to exert regulatory control over secretion and presynaptic differentiation by inhibiting the activity of N-type voltage-gated calcium channels. Additionally, it may activate the MAP kinase JNK, suggesting a potential role in intracellular signaling pathways. Furthermore, IL1RAPL1 is implicated in neurite outgrowth, indicating its involvement in the extension of neuronal processes. Notably, during dendritic spine formation, IL1RAPL1 can bidirectionally induce both pre- and post-synaptic differentiation of neurons through trans-synaptic binding to PTPRD. This multifaceted functionality underscores IL1RAPL1's significance in modulating various aspects of neuronal development and synaptic differentiation, with potential implications for neural circuit formation and function. Further investigation into the specific mechanisms and downstream effects of IL1RAPL1 in these processes could provide valuable insights into its role in neurodevelopment.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Recombinant Human PTPRD is immobilized at 1 µg/mL (100 µL/well) can bind Recombinant Mouse IL1RAPL1. The ED50 for this effect is 20.36 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Human PTPRD is immobilized at 1 µg/mL (100 µL/well) can bind Recombinant Mouse IL1RAPL1. The ED50 for this effect is 20.36 ng/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc
  • Accession

    P59823 (R25-T357)

  • Gene ID
    331461  [NCBI]
  • Molecular Construction
    • N-term
    • IL1RAPL1 (R25-T357)
      Accession # P59823
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    IL1RAPL1; Interleukin-1 Receptor Accessory Protein-Like 1; Prev. IL1RAPL; Oligophrenin-4; Prev. MRX10; IL-1-RAPL-1; Prev. MRX21; IL-1RAPL-1; Prev. MRX34; Interleukin 1 Receptor Accessory Protein-Like 1; IL1RAPL-1; Mental Retardation, X-Linked 34; TIGIRR-2

  • AA Sequence

    RGSADGCTDWSVDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKAWRPSIVFKRDTLLIKEVKEDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMESKLTVQETQLGGSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYT

  • Predicted Molecular Mass

    65 kDa

  • Molecular Weight

    Approximately 85-95 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When Recombinant Human PTPRD is immobilized at 1 µg/mL (100 µL/well) can bind Recombinant Mouse IL1RAPL1. The ED50 for this effect is 20.36 ng/mL.

  • IL1RAPL1 Protein, Mouse (HEK293, Fc) Product Image
    1/16
  • Experimental Validation Results for IL1RAPL1 Protein, Mouse (HEK293, Fc)
  • Experimental Validation Results for IL1RAPL1 Protein, Mouse (HEK293, Fc)
  • IL1RAPL1 Protein, Mouse (HEK293, Fc) Product Image