Copy Link Print Information

IMPA2 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

IMPA2, or Inositol monophosphatase 2, demonstrates enzymatic activity by utilizing various substrates such as myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP. Additionally, it has been implicated as the pharmacological target for the action of lithium ions (Li⁺) in the brain. IMPA2 Protein, Human (His) is the recombinant human-derived IMPA2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • IMPA2 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IMPA2, or Inositol monophosphatase 2, demonstrates enzymatic activity by utilizing various substrates such as myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP. Additionally, it has been implicated as the pharmacological target for the action of lithium ions (Li⁺) in the brain. IMPA2 Protein, Human (His) is the recombinant human-derived IMPA2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

IMPA2, or inositol monophosphatase 2, is a versatile enzyme that can utilize myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates. This enzymatic diversity suggests a role in inositol metabolism and phosphate cleavage from various inositol-containing molecules. Notably, IMPA2 has been implicated as the pharmacological target for lithium (Li+) action in the brain. The association with lithium suggests a potential role in the regulation of intracellular inositol levels, emphasizing the significance of IMPA2 in cellular processes and its involvement in the therapeutic action of lithium, a widely used mood stabilizer in psychiatric treatments.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    O14732-1 (M1-K288)

  • Gene ID
    3613  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • IMPA2 (M1-K288)
      Accession # O14732-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    IMPA2; IMPase 2; Inositol Monophosphatase 2; IMP 2; Inositol(Myo)-1(Or 4)-Monophosphatase 2; Inositol-1(Or 4)-Monophosphatase 2; Myo-Inositol Monophosphatase A2; Inositol-Phosphate Phosphatase; Myo-Inositol Monophosphatase 2; IMPA2 Protein; Inosine Monoph

  • AA Sequence

    MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK

  • Predicted Molecular Mass

    33.5 kDa

  • Molecular Weight

    Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 2 mM DTT, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • IMPA2 Protein, Human (His) Product Image
    1/16
  • IMPA2 Protein, Human (His) Product Image