IMPA2 Protein, Human (His)

IMPA2, or Inositol monophosphatase 2, demonstrates enzymatic activity by utilizing various substrates such as myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP. Additionally, it has been implicated as the pharmacological target for the action of lithium ions (Li⁺) in the brain. IMPA2 Protein, Human (His) is the recombinant human-derived IMPA2 protein, expressed by E. coli , with N-6*His labeled tag.

IMPA2, or inositol monophosphatase 2, is a versatile enzyme that can utilize myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates. This enzymatic diversity suggests a role in inositol metabolism and phosphate cleavage from various inositol-containing molecules. Notably, IMPA2 has been implicated as the pharmacological target for lithium (Li+) action in the brain. The association with lithium suggests a potential role in the regulation of intracellular inositol levels, emphasizing the significance of IMPA2 in cellular processes and its involvement in the therapeutic action of lithium, a widely used mood stabilizer in psychiatric treatments.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

O14732-1 (M1-K288)

3613  [NCBI]

Full Length of Isoform-1

MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK

Approximately 30 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 2 mM DTT, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.