1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Insulin
  5. Insulin-1/Ins1 Protein, Mouse (P.pastoris, Myc, His)

Insulin-1/Ins1 Protein, Mouse (P.pastoris, Myc, His)

Cat. No.: HY-P71805
Handling Instructions Technical Support

Insulin-1 is an important regulator of glucose and can effectively lower blood sugar by increasing cellular permeability to simple sugars, amino acids, and fatty acids.Its effects include accelerating glycolysis, promoting pentose phosphate cycle, and promoting hepatic glycogen synthesis.Insulin-1/Ins1 Protein, Mouse (P.pastoris, Myc, His) is the recombinant mouse-derived Insulin-1/Ins1 protein, expressed by P.pastoris , with C-Myc, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
20 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Insulin-1/Ins1 Protein, Mouse (P.pastoris, Myc, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Insulin-1 is an important regulator of glucose and can effectively lower blood sugar by increasing cellular permeability to simple sugars, amino acids, and fatty acids.Its effects include accelerating glycolysis, promoting pentose phosphate cycle, and promoting hepatic glycogen synthesis.Insulin-1/Ins1 Protein, Mouse (P.pastoris, Myc, His) is the recombinant mouse-derived Insulin-1/Ins1 protein, expressed by P.pastoris , with C-Myc, N-6*His labeled tag.

Background

Insulin-1, a key player in glucose regulation, effectively lowers blood glucose levels by enhancing cellular permeability to monosaccharides, amino acids, and fatty acids. Its multifaceted actions include the acceleration of glycolysis, promotion of the pentose phosphate cycle, and facilitation of glycogen synthesis in the liver. Structurally, Insulin-1 exists as a heterodimer comprising a B chain and an A chain, intricately linked by two disulfide bonds. These structural features underscore its crucial role in orchestrating metabolic processes essential for maintaining glucose homeostasis.

Species

Mouse

Source

P. pastoris

Tag

C-Myc;N-6*His

Accession

P01325 (F25-N108)

Gene ID

16333  [NCBI]

Molecular Construction
N-term
6*His
Ins1 (F25-N108)
Accession # P01325
Myc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Ins1; Ins-1; Insulin-1
AA Sequence

FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN

Predicted Molecular Mass
13.0 kDa
Molecular Weight

Approximately 29 kDa, based on SDS-PAGE under reducing conditions, due to relative charge.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Insulin-1/Ins1 Protein, Mouse (P.pastoris, Myc, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Insulin-1/Ins1 Protein, Mouse (P.pastoris, Myc, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Insulin-1/Ins1 Protein, Mouse (P.pastoris, Myc, His)
Cat. No.:
HY-P71805
Quantity:
MCE Japan Authorized Agent: