Integrin alpha X beta 2 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Integrin α-X/β-2 is a receptor for fibrinogen that recognizes GPR sequences. It plays a key role in inflammatory responses, particularly in monocyte adhesion and chemotaxis. Integrin alpha X beta 2 Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived Integrin alpha X beta 2 protein, expressed by HEK293 , with C-His labeled tag. Integrin alpha X beta 2 Protein, Human (HEK293, His), has molecular weight of 130-150 kDa (ITGAX) & 85-96 kDa (ITGB2), respectively.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Integrin α-X/β-2 is a receptor for fibrinogen that recognizes GPR sequences. It plays a key role in inflammatory responses, particularly in monocyte adhesion and chemotaxis. Integrin alpha X beta 2 Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived Integrin alpha X beta 2 protein, expressed by HEK293 , with C-His labeled tag. Integrin alpha X beta 2 Protein, Human (HEK293, His), has molecular weight of 130-150 kDa (ITGAX) & 85-96 kDa (ITGB2), respectively.

Background

The Integrin alpha-X/beta-2 protein serves as a receptor for fibrinogen, recognizing the G-P-R sequence in its ligands. Crucial for cell-cell interactions during inflammatory responses, Integrin alpha-X/beta-2 plays a particularly significant role in monocyte adhesion and chemotaxis. Structurally, it forms a heterodimer, consisting of an alpha and a beta subunit, with the alpha-X subunit associating with the beta-2 subunit. This receptor's recognition of fibrinogen and its involvement in inflammatory processes underscore its importance in facilitating immune responses, emphasizing its role in the regulation of monocyte functions and cell migration during inflammation.

Verified Bioactivity

1.Immobilized Human ITGAX&ITGB2, His Tag at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Anti-ITGB2 Antibody, hFc Tag with the EC50 of 26.8 ng/mL determined by ELISA.
2.Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human ITGAX&ITGB2 His Tag at 2 μg/mL can bind Anti-CD11c Antibody (HY-P81176). The ED50 for this effect is 24.48 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Synonyms

    ITGAX; Integrin Alpha-X; Prev. CD11C; Myeloid Membrane Antigen, Alpha Subunit; CD11c; P150 95 Integrin Alpha Chain; Integrin, Alpha X (Complement Component 3 Receptor 4 Subunit); Leu M5, Alpha Subunit; Integrin, Alpha X (Antigen CD11C (P150), Alpha Polype

  • AA Sequence

    A1:
    FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYKVHNPTP
    A2:
    QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNVCECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGRTCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPN

  • Molecular Weight

    Approximately 130-135 kDa (ITGAX) & 85-95 kDa (ITGB2), based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Structure/Form

    Heterodimer

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE or Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00