1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Irisin Protein, Human/Mouse/Rat (HEK293, His)

Irisin Protein, Human/Mouse/Rat (HEK293, His)

Cat. No.: HY-P70664
COA Handling Instructions

Irisin Protein, Human/Mouse/Rat (HEK293, His) is a Irisin protein labeled with a His-flag. Irisin is a hormone derived from the fibronectin type III domain-containing (FNDC5) gene that can promote energy expenditure via thermogenesis.

For research use only. We do not sell to patients.

Size Price Stock Quantity
Free Sample   Apply now  
2 μg $55 In-stock
10 μg $150 In-stock
50 μg $450 In-stock
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Irisin Protein, Human/Mouse/Rat (HEK293, His) is a Irisin protein labeled with a His-flag. Irisin is a hormone derived from the fibronectin type III domain-containing (FNDC5) gene that can promote energy expenditure via thermogenesis[1].

Background

Irisin is a recently identified hormone derived from the fibronectin type III domain-containing (FNDC5) gene that is released mainly from skeletal muscle after exercise or exposure to cold. Irisin is mainly secreted by muscle and is increased with exercise. In particular, Irisin has been shown to have beneficial effects in adipose tissues, brain and bone[2].
Recombinant Human/Mouse/Rat Irisin Protein (20-200 ng/ml; 24 hours) at low concentration has no effects on E-selectin expression. And when HUVECs are treated with high concentarion irisin (200 ng/ml), it results in soluble E-selectin concentrations similar to the levels detected in the control group treated with regular growth media[1].

Biological Activity

Measured by its ability to inhibit proliferation of A549 cells. The IC50 for this effect is 6.845 ng/mL, corresponding to a specific activity is 1.4609×105 units/mg.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q8NAU1 (D32-E143)

Gene ID
Synonyms
Fibronectin type III domain-containing protein 5; Fibronectin type III repeat-containing protein 2; Irisin; FNDC5
AA Sequence

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Molecular Weight

20-28 kDa

Purity
  • Measured by its ability to inhibit proliferation of A549 cells. The IC50 for this effect is 6.845 ng/mL , corresponding to a specific activity is 1.4609×105 units/mg.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Irisin Protein, Human/Mouse/Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Irisin Protein, Human/Mouse/Rat (HEK293, His)
Cat. No.:
HY-P70664
Quantity:
MCE Japan Authorized Agent: