1. Recombinant Proteins
  2. Irisin Protein, Human/Mouse/Rat (HEK293, His)

Irisin Protein, Human/Mouse/Rat (HEK293, His)

Cat. No.: HY-P70664
Handling Instructions

Irisin Protein, Human/Mouse/Rat (HEK293, His) is a Irisin protein labeled with a His-flag. Irisin is a hormone derived from the fibronectin type III domain-containing (FNDC5) gene that can promote energy expenditure via thermogenesis[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $150 In-stock
Estimated Time of Arrival: December 31
50 μg $450 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
Fibronectin type III domain-containing protein 5; Fibronectin type III repeat-containing protein 2; Irisin; FNDC5
Species

Human

Source

HEK 293

Accession

Q8NAU1 (D32-E143)

Gene ID

252995

Molecular Weight

20-28 kDa

AA Sequence

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Background

Irisin is a recently identified hormone derived from the fibronectin type III domain-containing (FNDC5) gene that is released mainly from skeletal muscle after exercise or exposure to cold. Irisin is mainly secreted by muscle and is increased with exercise. In particular, Irisin has been shown to have beneficial effects in adipose tissues, brain and bone[2].
Recombinant Human/Mouse/Rat Irisin Protein (20-200 ng/ml; 24 hours) at low concentration has no effects on E-selectin expression. And when HUVECs are treated with high concentarion irisin (200 ng/ml), it results in soluble E-selectin concentrations similar to the levels detected in the control group treated with regular growth media[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Irisin Protein, Human/Mouse/Rat (HEK293, His)
Cat. No.:
HY-P70664
Quantity:
MCE Japan Authorized Agent: