Irisin Protein, Human/Mouse/Rat (HEK293, His)

13 Cited Publications
Customer Review

Based on 13 publication(s) in Google Scholar

Irisin Protein is an important cytokine secreted by muscles during exercise, which has multiple functions such as regulating metabolism and improving health. Irisin Protein, Human/Mouse/Rat (HEK293, His) is a recombinant Irisin Protein expressed by HEK293 and carrying a C-6*His tag.

For research use only. We do not sell to patients.
  • Species: Human; Rat; Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

Irisin Protein is an important cytokine secreted by muscles during exercise, which has multiple functions such as regulating metabolism and improving health. Irisin Protein, Human/Mouse/Rat (HEK293, His) is a recombinant Irisin Protein expressed by HEK293 and carrying a C-6*His tag[1][2][3].

Background

Irisin is a myokine secreted by skeletal muscles that promotes fat metabolism, induces browning of white adipose tissue, participates in liver metabolism, and maintains glucose and lipid homeostasis. Additionally, Irisin can protect the cardiovascular system, skeletal muscles, and exert neuroprotective effects. The main receptor for Irisin is integrin αV/β5, which mediates its actions in tissues such as adipose, liver, and bone[1][2][3].

In Vitro

Irisin Protein (Human/Mouse/Rat; 100 ng/mL; 24 h) inhibits ROS production and MDA levels, enhances SOD activity, and reverses the increased expression of GSDMD-N, NLRP3, cleaved caspase-1 and the increased secretion of IL-1β and IL-18 in high glucose-treated Min6 cells[4].
Irisin Protein (Human/Mouse/Rat; 0-200 ng/mL; 72 h) inhibits tau K18-induced expression of P53, P21, P16 and SA-β-gal activity, as well as reduces the levels of pro-inflammatory factors TNF-α and IL-6 in BV2 microglial cells[5].

In Vivo

Irisin Protein (Human/Mouse/Rat; 0.25 μg/kg; intraperitoneal injection; 8 weeks) exerts a therapeutic effect in a mouse model of type 2 diabetes, restoring islet morphology, increasing the number of β-cells, and improving insulin resistance[4].
Irisin Protein (Human/Mouse/Rat; 250 µg/kg; weekly intraperitoneal injection; 3 months) exhibits neuroprotective effects in P301S transgenic mice, inhibiting microglial senescence and improving cognitive function and synaptic structure in mice[5].

Verified Bioactivity

Measured by its ability to induce p38 MAPK activation in 3T3 L1 mouse embryonic fibroblast adipose-like cells. 1 μg/mL of Recombinant Human Irisin can effectively induce p38 MAPK activation.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce p38 MAPK activation in 3T3 L1 mouse embryonic fibroblast adipose-like cells. 1 μg/mL of Recombinant Human Irisin can effectively induce p38 MAPK activation.

Technical Parameters

  • Species Human; Rat; Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Irisin (D32-E143)
      Accession # A0A0A0MRR6
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    FNDC5; Fibronectin Type III Domain-Containing Protein 5; Fibronectin Type III Domain Containing 5; Fibronectin Type III Repeat-Containing Protein 2; FRCP2; Irisin

  • AA Sequence

    DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

  • Predicted Molecular Mass

    12.6 kDa

  • Molecular Weight

    Approximately 20-28 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.2 μm filtered solution of PBS, 8% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00